CLCNKA Antibody - BSA Free

Immunohistochemistry: CLCNKA Antibody [NBP2-46842] - Staining of human kidney shows moderate cytoplasmic positivity in distal tubules.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CLCNKA Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IVKKLPYLPRILGRNIGSHHVRVEHFMNHSITTLA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLCNKA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CLCNKA Recombinant Protein Antigen (NBP2-46842PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CLCNKA Antibody - BSA Free

• chloride channel KaMGC61490
• hClC-Ka
• kidney, A

Background

The CLCNKA gene is a member of the CLC family of voltage-gated chloride channels. The encoded protein is predicted to have 12transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought tofunction in salt reabsor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLCNKA
• Entrez:
  • 1188(Human)
• Uniprot:
  • P51800(Human)