Novus Biologicals products are now on bio-techne.com

CLCNKA Antibody

Images

 
Western Blot: CLCNKA Antibody [NBP1-80067] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

CLCNKA Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the N terminal of human CLCNKA. Peptide sequence MEELVGLREGFSGDPVTLQELWGPCPHIRRAIQGGLEWLKQKVFRLGEDW. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLCNKA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for CLCNKA Antibody

  • chloride channel KaMGC61490
  • hClC-Ka
  • kidney, A

Background

The CLCNKA gene is a member of the CLC family of voltage-gated chloride channels. The encoded protein is predicted to have 12transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought tofunction in salt reabsor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001188-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-49101
Species: Hu
Applications: IHC, IHC-P
AF5447
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP1-89926
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-749
Species: Hu, Mu, Rb, Rt, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB110-74682
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-69123
Species: Mu, Rt
Applications: WB
NBP1-80993
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91791
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS272
Species: Ha, Hu, Pm, Mu, Rb, Rt
Applications: IHC, IHC-Fr, IHC-P
NBP2-24635
Species: Bv, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-86984
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, KD, WB
MAB1233
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
NBP2-92461
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-82874
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-80067
Species: Hu
Applications: WB

Publications for CLCNKA Antibody (NBP1-80067) (0)

There are no publications for CLCNKA Antibody (NBP1-80067).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLCNKA Antibody (NBP1-80067) (0)

There are no reviews for CLCNKA Antibody (NBP1-80067). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CLCNKA Antibody (NBP1-80067) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLCNKA Products

Research Areas for CLCNKA Antibody (NBP1-80067)

Find related products by research area.

Blogs on CLCNKA

There are no specific blogs for CLCNKA, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLCNKA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLCNKA
Uniprot