CLCN1 Antibody (0P2M8)

Western Blot: CLCN1 Antibody (0P2M8) [NBP3-33303] - Western blot analysis of various lysates, using CLCN1 Rabbit mAb at 1:20000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 60s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 0P2M8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CLCN1 Antibody (0P2M8) Summary

• Description: Novus Biologicals Rabbit CLCN1 Antibody (0P2M8) (NBP3-33303) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 889-988 of human CLCN1 (NP_000074.3).
  
  Sequence:
  NTTSTRKSTGAPPSSAENWNLPEDRPGATGTGDVIAASPETPVPSPSPEPPLSLAPGKVEGELEELELVESPGLEEELADILQGPSLRSTDEEDEDELIL
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CLCN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:2000 - 1:20000
• Theoretical MW: 109 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for CLCN1 Antibody (0P2M8)

• chloride channel 1, skeletal muscle
• Chloride channel protein, skeletal muscle
• CLC1
• ClC-1
• CLC1chloride channel protein 1
• CLCN1
• MGC138361
• MGC142055

Background

The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) whichdemonstrate quite diverse functional characteristics while sharing significant sequence homology. The protein encodedby this gene regulates the electric excitability of the skeletal muscle membrane. Mutations in this gene cause twoforms of inherited human muscle disorders: recessive generalized myotonia congenita (Becker) and dominant myotonia(Thomsen). (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLCN1