Claudin-2 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human Claudin-2. Peptide sequence: WMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVV The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CLDN2 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
1 mg/ml |
| Purity |
Protein A purified |
Alternate Names for Claudin-2 Antibody - BSA Free
Background
The Claudin superfamily consists of many structurally related proteins in humans. These proteins are important structural and functional components of tight junctions in paracellular transport. Claudins are located in both epithelial and endothelial cells in all tight junction-bearing tissues. Three classes of proteinsare known to localize to tight junctions, including the Claudins, Occludin and junction adhesion molecule (JAM). Claudins, which consist of four transmembrane domains and two extracellular loops, make up tight junction strands. Emerging evidence suggests that the Claudin family of proteins regulates transport through tight junctions via differential discrimination for solute size and charge. Claudin expression is often highly restricted to specfic regions of different tissues and may have an important role in transcellular transport through tight junctions.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Po
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Publications for Claudin-2 Antibody (NBP2-82696) (0)
There are no publications for Claudin-2 Antibody (NBP2-82696).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Claudin-2 Antibody (NBP2-82696) (0)
There are no reviews for Claudin-2 Antibody (NBP2-82696).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Claudin-2 Antibody (NBP2-82696) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Claudin-2 Products
Research Areas for Claudin-2 Antibody (NBP2-82696)
Find related products by research area.
|
Blogs on Claudin-2