Clathrin light chain + heavy chain Antibody

Images

 
Western Blot: Clathrin light chain + heavy chain Antibody [NBP1-69194] - Human Brain lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: Clathrin light chain + heavy chain Antibody [NBP1-69194] - Human Adult Prostate Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Clathrin light chain + heavy chain Antibody Summary

Immunogen
Synthetic peptides corresponding to CLTA (clathrin, light chain (Lca)) The peptide sequence was selected from the C terminal of CLTA. Peptide sequence KELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLTA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against CLTA and was validated on Western blot.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Clathrin light chain + heavy chain Antibody

  • clathrin light chain A
  • clathrin, light chain A
  • Lca
  • light polypeptide (Lca)

Background

Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 8 and 12.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-683
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-69194
Species: Hu
Applications: WB, IHC

Publications for Clathrin light chain + heavy chain Antibody (NBP1-69194) (0)

There are no publications for Clathrin light chain + heavy chain Antibody (NBP1-69194).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Clathrin light chain + heavy chain Antibody (NBP1-69194) (0)

There are no reviews for Clathrin light chain + heavy chain Antibody (NBP1-69194). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Clathrin light chain + heavy chain Antibody (NBP1-69194) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Clathrin light chain + heavy chain Products

Clathrin light chain + heavy chain NBP1-69194

Bioinformatics Tool for Clathrin light chain + heavy chain Antibody (NBP1-69194)

Discover related pathways, diseases and genes to Clathrin light chain + heavy chain Antibody (NBP1-69194). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Clathrin light chain + heavy chain Antibody (NBP1-69194)

Discover more about diseases related to Clathrin light chain + heavy chain Antibody (NBP1-69194).
 

Pathways for Clathrin light chain + heavy chain Antibody (NBP1-69194)

View related products by pathway.

Research Areas for Clathrin light chain + heavy chain Antibody (NBP1-69194)

Find related products by research area.

Blogs on Clathrin light chain + heavy chain

There are no specific blogs for Clathrin light chain + heavy chain, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Clathrin light chain heavy chain Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLTA