CLASRP Antibody

Images

 
Western Blot: CLASRP Antibody [NBP2-32548] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunocytochemistry/ Immunofluorescence: CLASRP Antibody [NBP2-32548] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: CLASRP Antibody [NBP2-32548] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CLASRP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NSDEDEVIPDIDVEVDVDELNQEQVADLNKQATTYGMADGDFVRMLRKDKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLASRP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CLASRP Protein (NBP2-32548PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CLASRP Antibody

  • CLASP
  • Clk4 Associating SR-Related Protein
  • CLK4-Associating Serine/Arginine Rich Protein
  • SFRS16
  • Splicing Factor, Arginine/Serine-Rich 16 (Suppressor-Of-White-ApricotHomolog, Drosophila)
  • Splicing Factor, Arginine/Serine-Rich 16
  • Suppressor Of White Apricot Homolog 2
  • Suppressor Of White-Apricot Homolog 2
  • SWAP2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86214
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84928
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-21395
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP2-00714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88707
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009167-B02P
Species: Hu
Applications: WB, ELISA
H00056899-P01
Species: Hu
H00010849-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-3515
Species: Hu, Rt, Po, Bv, Ca, Fi, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, ICC
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85568
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85569
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24740
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP1-76636
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88518
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB500-182
Species: Hu, Mu, Rt, Ma
Applications: WB, ICC/IF, IP
NBP2-32548
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CLASRP Antibody (NBP2-32548) (0)

There are no publications for CLASRP Antibody (NBP2-32548).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLASRP Antibody (NBP2-32548) (0)

There are no reviews for CLASRP Antibody (NBP2-32548). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CLASRP Antibody (NBP2-32548) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CLASRP Products

Bioinformatics Tool for CLASRP Antibody (NBP2-32548)

Discover related pathways, diseases and genes to CLASRP Antibody (NBP2-32548). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CLASRP

There are no specific blogs for CLASRP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CLASRP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLASRP