CL-K1/COLEC11 Antibody

Images

 
Immunohistochemistry-Paraffin: CL-K1/COLEC11 Antibody [NBP1-81120] - Staining of human liver shows cytoplasmic positivity in hepatocytes and nuclear in sinusoids.

Product Details

Summary
Reactivity Hu, Pa, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CL-K1/COLEC11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: INDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COLEC11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CL-K1/COLEC11 Recombinant Protein Antigen (NBP1-81120PEP)
Publications
Read Publication using
NBP1-81120 in the following applications:

Reactivity Notes

Parasite reactivity reported in scientific literature (PMID:32827454).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CL-K1/COLEC11 Antibody

  • CLK1
  • CL-K1
  • CL-K1-I
  • CL-K1-II
  • CL-K1-IIa
  • CL-K1-IIb
  • COLEC11
  • collectin kidney I
  • Collectin kidney protein 1
  • collectin sub-family member 11
  • collectin-11
  • DKFZp686N1868
  • MGC3279

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66861
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-20324
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00001859-M01
Species: Hu, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF6387
Species: Hu
Applications: WB
NBP2-87195
Species: Hu
Applications: WB
NBP2-47506
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81761
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00001198-M05
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
H00010921-M05
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
NBP2-37888
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP3-04502
Species: Hu
Applications: ICC/IF, WB
NBP2-15843
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-98496
Species: Hu
Applications: WB
AF5414
Species: Hu
Applications: Simple Western, WB
2914-HT
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA

Publications for CL-K1/COLEC11 Antibody (NBP1-81120)(1)

We have publications tested in 1 confirmed species: Parasite.

We have publications tested in 2 applications: Flow, ICC/IF.


Filter By Application
Flow
(1)
ICC/IF
(1)
All Applications
Filter By Species
Parasite
(1)
All Species

Reviews for CL-K1/COLEC11 Antibody (NBP1-81120) (0)

There are no reviews for CL-K1/COLEC11 Antibody (NBP1-81120). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CL-K1/COLEC11 Antibody (NBP1-81120) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CL-K1/COLEC11 Products

Bioinformatics Tool for CL-K1/COLEC11 Antibody (NBP1-81120)

Discover related pathways, diseases and genes to CL-K1/COLEC11 Antibody (NBP1-81120). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CL-K1/COLEC11 Antibody (NBP1-81120)

Discover more about diseases related to CL-K1/COLEC11 Antibody (NBP1-81120).
 

Pathways for CL-K1/COLEC11 Antibody (NBP1-81120)

View related products by pathway.

Research Areas for CL-K1/COLEC11 Antibody (NBP1-81120)

Find related products by research area.

Blogs on CL-K1/COLEC11

There are no specific blogs for CL-K1/COLEC11, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CL-K1/COLEC11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COLEC11
Entrez
Uniprot