CKS2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CKS2 Antibody [NBP2-58720] - Staining of human cell line A549 shows localization to cytosol & mitochondria.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CKS2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQ
Specificity
Specificity of human CKS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CKS2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
CKS2 Knockout 293T Cell Lysate
Control Peptide
CKS2 Recombinant Protein Antigen (NBP2-58720PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CKS2 Antibody

  • CDC28 protein kinase 2
  • CDC28 protein kinase regulatory subunit 2
  • CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2
  • CKS-2
  • CKSHS2
  • cyclin-dependent kinases regulatory subunit 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001163-B01P
Species: Hu, Rt
Applications: WB
NBP2-00776
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-44687
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P
NBP2-49142
Species: Hu
Applications: WB, IHC, IHC-P, KD
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67719
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, Gp, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Dual ISH-IHC, KD
NBP2-46085
Species: Hu
Applications: WB, IHC
NB600-335
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-87947
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP1-87905
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90949
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-68858
Species: Hu
Applications: IHC, IHC-P

Publications for CKS2 Antibody (NBP2-58720) (0)

There are no publications for CKS2 Antibody (NBP2-58720).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CKS2 Antibody (NBP2-58720) (0)

There are no reviews for CKS2 Antibody (NBP2-58720). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CKS2 Antibody (NBP2-58720) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CKS2 Products

Bioinformatics Tool for CKS2 Antibody (NBP2-58720)

Discover related pathways, diseases and genes to CKS2 Antibody (NBP2-58720). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CKS2 Antibody (NBP2-58720)

Discover more about diseases related to CKS2 Antibody (NBP2-58720).
 

Pathways for CKS2 Antibody (NBP2-58720)

View related products by pathway.

PTMs for CKS2 Antibody (NBP2-58720)

Learn more about PTMs related to CKS2 Antibody (NBP2-58720).
 

Research Areas for CKS2 Antibody (NBP2-58720)

Find related products by research area.

Blogs on CKS2

There are no specific blogs for CKS2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CKS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CKS2