CKII alpha prime polypeptide Antibody [mFluor Violet 610 SE] Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-350 of human CKII alpha prime polypeptide (NP_001887.1).
Sequence: MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CSNK2A2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
50mM Sodium Borate |
Preservative |
0.05% Sodium Azide |
Purity |
Affinity purified |
Notes
mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
Alternate Names for CKII alpha prime polypeptide Antibody [mFluor Violet 610 SE]
Background
CKII alpha is involved in leukemogensis and tumorigenesis. It is a catalytic, ubiquitous cellular kinase that can use ATP and GTP as phosphorylation donors. CKII alpha also plays a role in many proliferation-related processes in the cell.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Av, Bv, Sh
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu
Applications: ChIP, ICC, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Species: Ha, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB, ELISA
Publications for CKII alpha prime polypeptide Antibody (NBP3-37929MFV610) (0)
There are no publications for CKII alpha prime polypeptide Antibody (NBP3-37929MFV610).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CKII alpha prime polypeptide Antibody (NBP3-37929MFV610) (0)
There are no reviews for CKII alpha prime polypeptide Antibody (NBP3-37929MFV610).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CKII alpha prime polypeptide Antibody (NBP3-37929MFV610) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CKII alpha prime polypeptide Products
Research Areas for CKII alpha prime polypeptide Antibody (NBP3-37929MFV610)
Find related products by research area.
|
Blogs on CKII alpha prime polypeptide