CKII alpha prime polypeptide Antibody


Western Blot: CKII alpha prime polypeptide Antibody [NBP1-56690] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CKII alpha prime polypeptide Antibody Summary

Synthetic peptides corresponding to CSNK2A2(casein kinase 2, alpha prime polypeptide) The peptide sequence was selected from the C terminal of CSNK2A2. Peptide sequence GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD.
This product is specific to Subunit or Isoform: alpha'.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CSNK2A2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CKII alpha prime polypeptide Antibody

  • casein kinase 2, alpha prime polypeptide
  • casein kinase II subunit alpha'
  • CK II alpha'
  • CK2A2
  • CSNK2A1
  • EC 2.7.11
  • EC
  • FLJ43934


CSNK2A2 belongs to the protein kinase superfamily, Ser/Thr protein kinase family, CK2 subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. CSNK2A2 participates in Wnt signaling. It phosphorylates 'Ser-392' of p53/TP53 following UV irradiation.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Mu, Rt
Applications: WB, ICC/IF, IP, ICC, IF
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IA, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu
Applications: WB

Publications for CKII alpha prime polypeptide Antibody (NBP1-56690) (0)

There are no publications for CKII alpha prime polypeptide Antibody (NBP1-56690).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CKII alpha prime polypeptide Antibody (NBP1-56690) (0)

There are no reviews for CKII alpha prime polypeptide Antibody (NBP1-56690). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CKII alpha prime polypeptide Antibody (NBP1-56690) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CKII alpha prime polypeptide Products

Bioinformatics Tool for CKII alpha prime polypeptide Antibody (NBP1-56690)

Discover related pathways, diseases and genes to CKII alpha prime polypeptide Antibody (NBP1-56690). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CKII alpha prime polypeptide Antibody (NBP1-56690)

Discover more about diseases related to CKII alpha prime polypeptide Antibody (NBP1-56690).

Pathways for CKII alpha prime polypeptide Antibody (NBP1-56690)

View related products by pathway.

PTMs for CKII alpha prime polypeptide Antibody (NBP1-56690)

Learn more about PTMs related to CKII alpha prime polypeptide Antibody (NBP1-56690).

Research Areas for CKII alpha prime polypeptide Antibody (NBP1-56690)

Find related products by research area.

Blogs on CKII alpha prime polypeptide

There are no specific blogs for CKII alpha prime polypeptide, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CKII alpha prime polypeptide Antibody and receive a gift card or discount.


Gene Symbol CSNK2A2