CKII alpha prime polypeptide Antibody

Images

 
Western Blot: CKII alpha prime polypeptide Antibody [NBP1-56690] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CKII alpha prime polypeptide Antibody Summary

Immunogen
Synthetic peptides corresponding to CSNK2A2(casein kinase 2, alpha prime polypeptide) The peptide sequence was selected from the C terminal of CSNK2A2. Peptide sequence GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD.
Specificity
This product is specific to Subunit or Isofrom: alpha'.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSNK2A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CSNK2A2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CKII alpha prime polypeptide Antibody

  • casein kinase 2, alpha prime polypeptide
  • casein kinase II subunit alpha'
  • CK II alpha'
  • CK2A2
  • CSNK2A1
  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ43934

Background

CSNK2A2 belongs to the protein kinase superfamily, Ser/Thr protein kinase family, CK2 subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. CSNK2A2 participates in Wnt signaling. It phosphorylates 'Ser-392' of p53/TP53 following UV irradiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77242
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB120-3420
Species: Mu, Rt
Applications: WB, ICC/IF, IP, ICC, IF
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-52449
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-35006
Species: Hu
NBP1-89326
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP2-13636
Species: Hu
Applications: IHC, IHC-P
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-91966
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33842
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-56690
Species: Hu
Applications: WB

Publications for CKII alpha prime polypeptide Antibody (NBP1-56690) (0)

There are no publications for CKII alpha prime polypeptide Antibody (NBP1-56690).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CKII alpha prime polypeptide Antibody (NBP1-56690) (0)

There are no reviews for CKII alpha prime polypeptide Antibody (NBP1-56690). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CKII alpha prime polypeptide Antibody (NBP1-56690) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CKII alpha prime polypeptide Products

Bioinformatics Tool for CKII alpha prime polypeptide Antibody (NBP1-56690)

Discover related pathways, diseases and genes to CKII alpha prime polypeptide Antibody (NBP1-56690). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CKII alpha prime polypeptide Antibody (NBP1-56690)

Discover more about diseases related to CKII alpha prime polypeptide Antibody (NBP1-56690).
 

Pathways for CKII alpha prime polypeptide Antibody (NBP1-56690)

View related products by pathway.

PTMs for CKII alpha prime polypeptide Antibody (NBP1-56690)

Learn more about PTMs related to CKII alpha prime polypeptide Antibody (NBP1-56690).
 

Research Areas for CKII alpha prime polypeptide Antibody (NBP1-56690)

Find related products by research area.

Blogs on CKII alpha prime polypeptide

There are no specific blogs for CKII alpha prime polypeptide, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CKII alpha prime polypeptide Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSNK2A2
Uniprot