CKII alpha prime polypeptide Antibody - BSA Free

Western Blot: CKII alpha prime polypeptide Antibody [NBP1-56402] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CKII alpha prime polypeptide Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CSNK2A2(casein kinase 2, alpha prime polypeptide) The peptide sequence was selected from the C terminal of CSNK2A2. Peptide sequence LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: alpha'.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CSNK2A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunoprecipitation
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CKII alpha prime polypeptide Antibody - BSA Free

• casein kinase 2, alpha prime polypeptide
• casein kinase II subunit alpha'
• CK II alpha'
• CK2A2
• CKII alpha prime polypeptide
• CSNK2A1
• CSNK2A2
• EC 2.7.11
• EC 2.7.11.1
• FLJ43934

Background

CSNK2A2 belongs to the protein kinase superfamily, Ser/Thr protein kinase family, CK2 subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. CSNK2A2 participates in Wnt signaling. It phosphorylates 'Ser-392' of p53/TP53 following UV irradiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CSNK2A2
• Uniprot:
  • P19784(Human)