Recombinant Human CITED4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CITED4 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 131 - 184 of Human CITED4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC

Protein/Peptide Type
Partial Recombinant Protein
Gene
CITED4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CITED4 Protein

  • cbp/p300-interacting transactivator 4
  • Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain4,MRG-2
  • MRG2
  • MSG1-related protein 2
  • transcriptional co-activator 4

Background

CITED4 belongs to a family of transcriptional coactivators that bind several proteins, including CREB-binding protein (MIM 600140) and p300 (MIM 602700).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-136
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
MAB7555
Species: Hu
Applications: WB, Simple Western
NB100-314
Species: Hu
Applications: WB, IP, PLA
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00006322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00000013-M01
Species: Hu
Applications: WB, ELISA
H00163732-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CITED4 Partial Recombinant Protein (H00163732-Q01) (0)

There are no publications for CITED4 Partial Recombinant Protein (H00163732-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CITED4 Partial Recombinant Protein (H00163732-Q01) (0)

There are no reviews for CITED4 Partial Recombinant Protein (H00163732-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CITED4 Partial Recombinant Protein (H00163732-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CITED4 Products

Bioinformatics Tool for CITED4 Partial Recombinant Protein (H00163732-Q01)

Discover related pathways, diseases and genes to CITED4 Partial Recombinant Protein (H00163732-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CITED4 Partial Recombinant Protein (H00163732-Q01)

Discover more about diseases related to CITED4 Partial Recombinant Protein (H00163732-Q01).
 

Pathways for CITED4 Partial Recombinant Protein (H00163732-Q01)

View related products by pathway.

PTMs for CITED4 Partial Recombinant Protein (H00163732-Q01)

Learn more about PTMs related to CITED4 Partial Recombinant Protein (H00163732-Q01).

Blogs on CITED4

There are no specific blogs for CITED4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CITED4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CITED4