CISH/CIS-1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CISH. Source: E. coli
Amino Acid Sequence: APSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKVLDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSR Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
CISH |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38474. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for CISH/CIS-1 Recombinant Protein Antigen
Background
CISH is encoded by this gene contains a SH2 domain and a SOCS box domain. The protein thus belongs to the cytokine-induced STAT inhibitor (CIS), also known as suppressor of cytokine signaling (SOCS) or STAT-induced STAT inhibitor (SSI), protein family. CIS family members are known to be cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by IL2, IL3, GM-CSF and EPO in hematopoietic cells. Proteasome-mediated degradation of this protein has been shown to be involved in the inactivation of the erythropoietin receptor.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Mu
Applications: BA
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Publications for CISH/CIS-1 Protein (NBP2-38474PEP) (0)
There are no publications for CISH/CIS-1 Protein (NBP2-38474PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CISH/CIS-1 Protein (NBP2-38474PEP) (0)
There are no reviews for CISH/CIS-1 Protein (NBP2-38474PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for CISH/CIS-1 Protein (NBP2-38474PEP) (0)
Additional CISH/CIS-1 Products
Research Areas for CISH/CIS-1 Protein (NBP2-38474PEP)
Find related products by research area.
|
Blogs on CISH/CIS-1