Cip4 Antibody

Images

 
Immunohistochemistry: Cip4 Antibody [NBP2-68971] - Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cip4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELEVVPIIA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIP10
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
Recommended conditions for IHC,Retrieval method: HIER pH6

Reactivity Notes

Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Cip4 Antibody

  • cdc42-interacting protein 4
  • CIP4STOT
  • HSTP
  • Protein Felic
  • Salt tolerant protein
  • salt tolerator
  • STPTRIP-10
  • thyroid hormone receptor interactor 10
  • thyroid receptor interacting protein 10
  • Thyroid receptor-interacting protein 10
  • TR-interacting protein 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48542
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88191
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-76845
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP2-52587
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
MAB6460
Species: Hu
Applications: WB, IHC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-20089
Species: Hu
Applications: WB, ICC/IF
NBP1-82512
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00023433-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP2-68971
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for Cip4 Antibody (NBP2-68971) (0)

There are no publications for Cip4 Antibody (NBP2-68971).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cip4 Antibody (NBP2-68971) (0)

There are no reviews for Cip4 Antibody (NBP2-68971). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cip4 Antibody (NBP2-68971) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Cip4 Products

Bioinformatics Tool for Cip4 Antibody (NBP2-68971)

Discover related pathways, diseases and genes to Cip4 Antibody (NBP2-68971). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cip4 Antibody (NBP2-68971)

Discover more about diseases related to Cip4 Antibody (NBP2-68971).
 

Pathways for Cip4 Antibody (NBP2-68971)

View related products by pathway.

PTMs for Cip4 Antibody (NBP2-68971)

Learn more about PTMs related to Cip4 Antibody (NBP2-68971).

Blogs on Cip4

There are no specific blogs for Cip4, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cip4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIP10
Novus 100% Guarantee