Cip4 Antibody - BSA Free

Immunohistochemistry: Cip4 Antibody [NBP2-68940] - Immunohistochemical staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cip4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cip4 Antibody - BSA Free (NBP2-68940) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QIAETLSNIERLKLEVQKYEAWLAEAESRVLSNRGDSLSRHARPPDPPASAPPDSSSNSASQDTKESSEE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIP10
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  Cip4 Recombinant Protein Antigen (NBP2-68940PEP)

Reactivity Notes

Mouse 86%, Rat 86%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for Cip4 Antibody - BSA Free

• cdc42-interacting protein 4
• CIP4STOT
• HSTP
• Protein Felic
• Salt tolerant protein
• salt tolerator
• STPTRIP-10
• thyroid hormone receptor interactor 10
• thyroid receptor interacting protein 10
• Thyroid receptor-interacting protein 10
• TR-interacting protein 10

Background

TRIP10/CIP4 is a multi-functional adapter protein and plays a role in the translocation of Glut4 (glucose transporter) vesicles to the cell surface in response to insulin. TRIP10/CIP4 has also been found to interact with the active GTPases CDC42 and TC10 as well as the Wiskott-Aldrich syndrome protein (WASP), a protein involved in cytoskeletal organization. Recent studies suggest that CIP4 accumulation may play a role in Huntington's disease pathogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIP10