Cip4 Antibody (6C3I3)

Western Blot: Cip4 Antibody (6C3I3) [NBP3-33218] - Western blot analysis of various lysates, using Cip4 Rabbit mAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clone: 6C3I3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Cip4 Antibody (6C3I3) Summary

• Description: Novus Biologicals Rabbit Cip4 Antibody (6C3I3) (NBP3-33218) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cip4 (Q15642).
  
  Sequence:
  MDWGTELWDQFEVLERHTQWGLDLLDRYVKFVKERTEVEQAYAKQLRSLVKKYLPKRPAKDDPESKFSQQQSFVQILQEVNDFAGQRELVAENLSVRVCL
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TRIP10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:100 - 1:500
• Theoretical MW: 68 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cip4 Antibody (6C3I3)

• cdc42-interacting protein 4
• CIP4STOT
• HSTP
• Protein Felic
• Salt tolerant protein
• salt tolerator
• STPTRIP-10
• thyroid hormone receptor interactor 10
• thyroid receptor interacting protein 10
• Thyroid receptor-interacting protein 10
• TR-interacting protein 10

Background

TRIP10/CIP4 is a multi-functional adapter protein and plays a role in the translocation of Glut4 (glucose transporter) vesicles to the cell surface in response to insulin. TRIP10/CIP4 has also been found to interact with the active GTPases CDC42 and TC10 as well as the Wiskott-Aldrich syndrome protein (WASP), a protein involved in cytoskeletal organization. Recent studies suggest that CIP4 accumulation may play a role in Huntington's disease pathogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIP10