CIDEA Antibody

Images

 
Western Blot: CIDEA Antibody [H00001149-D01P] - Analysis of CIDEA expression in transfected 293T cell line by CIDEA polyclonal antibody.Lane 1: CIDEA transfected lysate(28.30 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CIDEA Antibody Summary

Immunogen
CIDEA (NP_938031.1, 1 a.a. - 253 a.a.) full-length human protein. MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG
Specificity
CIDEA - cell death-inducing DFFA-like effector a,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CIDEA
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CIDEA Antibody

  • cell death activator CIDE-A
  • cell death-inducing DFFA-like effector aCIDE-A
  • CIDEA

Background

This gene encodes the homolog of the mouse protein Cidea that has been shown to activate apoptosis. This activation of apoptosis is inhibited by the DNA fragmentation factor DFF45 but not by caspase inhibitors. Mice that lack functional Cidea have higher metabolic rates, higher lipolysis in brown adipose tissue and higher core body temperatures when subjected to cold. These mice are also resistant to diet-induced obesity and diabetes. This suggests that in mice this gene product plays a role in thermogenesis and lipolysis. Two alternative transcripts encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-430
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-55757
Species: Mu
Applications: WB
NBP1-76471
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP2-13674
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14344
Species: Hu
Applications: WB, IHC, IHC-P
NB120-13592
Species: Hu
Applications: WB
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP1-00227
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF7550
Species: Hu
Applications: WB
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
H00001149-D01P
Species: Hu
Applications: WB

Publications for CIDEA Antibody (H00001149-D01P) (0)

There are no publications for CIDEA Antibody (H00001149-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CIDEA Antibody (H00001149-D01P) (0)

There are no reviews for CIDEA Antibody (H00001149-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CIDEA Antibody (H00001149-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CIDEA Products

Bioinformatics Tool for CIDEA Antibody (H00001149-D01P)

Discover related pathways, diseases and genes to CIDEA Antibody (H00001149-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CIDEA Antibody (H00001149-D01P)

Discover more about diseases related to CIDEA Antibody (H00001149-D01P).
 

Pathways for CIDEA Antibody (H00001149-D01P)

View related products by pathway.

PTMs for CIDEA Antibody (H00001149-D01P)

Learn more about PTMs related to CIDEA Antibody (H00001149-D01P).
 

Research Areas for CIDEA Antibody (H00001149-D01P)

Find related products by research area.

Blogs on CIDEA

There are no specific blogs for CIDEA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CIDEA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CIDEA
Entrez