CIAPIN1 Antibody

Images

 
Western Blot: CIAPIN1 Antibody [NBP1-89096] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: CIAPIN1 Antibody [NBP1-89096] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.
Western Blot: CIAPIN1 Antibody [NBP1-89096] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Product Details

Summary
Reactivity Hu, Mu, Rt, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CIAPIN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CIAPIN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunofluorescence 1-4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CIAPIN1 Protein (NBP1-89096PEP)
Publications
Read Publication using
NBP1-89096 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25012650).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CIAPIN1 Antibody

  • Anamorsin
  • cytokine induced apoptosis inhibitor 1
  • Cytokine-induced apoptosis inhibitor 1
  • DRE2
  • Fe-S cluster assembly protein DRE2 homolog
  • predicted protein of HQ0915,2810413N20Rik
  • PRO0915

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46466
Species: Hu
Applications: IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF7560
Species: Hu, Mu, Rt
Applications: WB
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP2-45856
Species: Hu
Applications: WB, IHC, IF
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
AF6108
Species: Hu
Applications: IHC
NBP2-46383
Species: Hu
Applications: WB, Flow, IHC
NBP1-83537
Species: Hu
Applications: IHC, IHC-P
NBP1-89096
Species: Hu, Mu, Rt, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF

Publications for CIAPIN1 Antibody (NBP1-89096)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CIAPIN1 Antibody (NBP1-89096) (0)

There are no reviews for CIAPIN1 Antibody (NBP1-89096). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CIAPIN1 Antibody (NBP1-89096) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CIAPIN1 Products

Bioinformatics Tool for CIAPIN1 Antibody (NBP1-89096)

Discover related pathways, diseases and genes to CIAPIN1 Antibody (NBP1-89096). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CIAPIN1 Antibody (NBP1-89096)

Discover more about diseases related to CIAPIN1 Antibody (NBP1-89096).
 

Pathways for CIAPIN1 Antibody (NBP1-89096)

View related products by pathway.

Research Areas for CIAPIN1 Antibody (NBP1-89096)

Find related products by research area.

Blogs on CIAPIN1

There are no specific blogs for CIAPIN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CIAPIN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CIAPIN1