CIAPIN1 Antibody - BSA Free

Immunohistochemistry-Paraffin: CIAPIN1 Antibody [NBP1-89096] - Analysis in human testis and skeletal muscle tissues using NBP1-89096 antibody. Corresponding CIAPIN1 RNA-seq data are presented for the same tissues.

Western Blot: CIAPIN1 Antibody [NBP1-89096] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: CIAPIN1 Antibody [NBP1-89096] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

Western Blot: CIAPIN1 Antibody [NBP1-89096] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Immunohistochemistry-Paraffin: CIAPIN1 Antibody [NBP1-89096] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: CIAPIN1 Antibody [NBP1-89096] - Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: CIAPIN1 Antibody [NBP1-89096] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CIAPIN1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CIAPIN1 Antibody - BSA Free (NBP1-89096) is a polyclonal antibody validated for use in IHC and WB. Anti-CIAPIN1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CIAPIN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 25012650). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CIAPIN1 Protein (NBP1-89096PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25012650).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CIAPIN1 Antibody - BSA Free

• Anamorsin
• cytokine induced apoptosis inhibitor 1
• Cytokine-induced apoptosis inhibitor 1
• DRE2
• Fe-S cluster assembly protein DRE2 homolog
• predicted protein of HQ0915,2810413N20Rik
• PRO0915

Background

CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CIAPIN1 Antibody (NBP1-89096)(2)

Publications using NBP1-89096

• Muir CA, Bork BS, Neff BD, Damjanovski S Proteomic analysis of temperature-dependent developmental plasticity within the ventricle of juvenile Atlantic salmon (Salmo salar) Current research in physiology 2022-08-10 [PMID: 36035983] (WB, Fish)
• Ferecatu I, Gonocalves S, Golinelli-Cohen MP et al. The Diabetes Drug Target MitoNEET Governs a Novel Trafficking Pathway to Rebuild an Fe-S Cluster into Cytosolic Aconitase/Iron Regulatory Protein 1. J Biol Chem 2014-10-10 [PMID: 25012650] (WB, Human)

Bioinformatics

• Gene Symbol: CIAPIN1