cIAP-1/HIAP-2 Recombinant Protein Antigen

Images

 
There are currently no images for cIAP-1/HIAP-2 Protein (NBP1-90133PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

cIAP-1/HIAP-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BIRC2.

Source: E. coli

Amino Acid Sequence: NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BIRC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90133.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for cIAP-1/HIAP-2 Recombinant Protein Antigen

  • API1Hiap-2
  • apoptosis inhibitor 1
  • baculoviral IAP repeat containing 2
  • baculoviral IAP repeat-containing 2
  • baculoviral IAP repeat-containing protein 2
  • BIRC2
  • cIAP1
  • C-IAP1
  • cIAP-1
  • hIAP2
  • HIAP-2
  • IAP homolog B
  • IAP2
  • IAP-2
  • Inhibitor of apoptosis protein 2
  • MIHB
  • MIHBHIAP2
  • NFR2-TRAF signalling complex protein
  • RING finger protein 48
  • RNF48hiap-2
  • TNFR2-TRAF-signaling complex protein 2

Background

cIAP1 (HIAP2, MIHB) is a member of the family of inhibitor of apoptosis proteins (IAP). IAPs suppress mitochondria-dependent and -independent apoptosis by binding to and inhibiting caspases through their BIR domains (reviewed in Liston et al, 2003; Wright and Duckett, 2005). Resistance towards apoptosis is a hallmark of cancer cells, and overexpression of IAPs can contribute to the development of cancer though inhibiting apoptosis. In addition to at least one BIR domain, some IAP members also have a RING-type finger motif at their carboxyl-terminal. The RING finger domain of several IAPs, including cIAP2, have E3 ubiquitin ligase activity and target the degradation of Smac/DIABLO through ubqiuitination. Smac/DIABLO is a death inducer and functions by inhibiting IAP-caspase interactions, thereby promoting apoptosis. Degradation of cell death inducers like Smac/DIABLO is thought to be a conserved mechanism by which IAPs enhance their anti-apoptotic activity, thereby promoting cell survival. The IAPs, including cIAP1, have widespread tissue protein expression, with expression levels and subcellular localization patterns differing depending on the cell lineage (see Vischioni et al. 2005 for a comprehensive study). This antibody recognizes cIAP1, human cIAP1 is a 618 amino acid protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8171
Species: Hu
Applications: IHC, Simple Western, WB
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP3-25355
Species: Dr, Hu, Mu
Applications: IHC,  IHC-P, WB
AF4670
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, Neut, WB
NBP2-33680
Species: Hu
Applications: IHC,  IHC-P
NBP2-14214
Species: Hu
Applications: IHC,  IHC-P
NB100-56311
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB3277
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-56144
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB100-56170
Species: Bv, Ca, Hu
Applications: IHC,  IHC-P, IP, WB
NB100-2176
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
375-TL
Species: Hu
Applications: BA
NBP1-90133PEP
Species: Hu
Applications: AC

Publications for cIAP-1/HIAP-2 Protein (NBP1-90133PEP) (0)

There are no publications for cIAP-1/HIAP-2 Protein (NBP1-90133PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for cIAP-1/HIAP-2 Protein (NBP1-90133PEP) (0)

There are no reviews for cIAP-1/HIAP-2 Protein (NBP1-90133PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for cIAP-1/HIAP-2 Protein (NBP1-90133PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional cIAP-1/HIAP-2 Products

Research Areas for cIAP-1/HIAP-2 Protein (NBP1-90133PEP)

Find related products by research area.

Blogs on cIAP-1/HIAP-2.


  Read full blog post.

cIAP1 - An apoptotic regulator with implications in drug resistant cancers
Cellular inhibitor of apoptosis protein-1 (cIAP-1) is an anti-apoptotic protein that is able to bind to caspases and inhibit their activity. Additionally cIAP-1 contains a RING domain with E3 ubiquitin ligase activity that is able to mediate the r...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our cIAP-1/HIAP-2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BIRC2