CHTF8 Antibody

Images

 
Western Blot: CHTF8 Antibody [NBP2-30490] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry: CHTF8 Antibody [NBP2-30490] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.
Immunofluorescence: CHTF8 Antibody [NBP2-30490] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHTF8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PIGPNSAHFSRPVGPMGVNANPFPRGAGSSAFSQSSGTLASNPATFQRSAGLQGSNPTIFPRASGPLGPNPANFPRAT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHTF8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CHTF8 Protein (NBP2-30490PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHTF8 Antibody

  • chromosome transmission fidelity protein 8 homolog
  • CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae)
  • CTF8hCTF8
  • Decreased expression in renal and prostate cancer protein
  • DERPCchromosome transmission fidelity factor 8 homolog
  • FLJ20400

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-03346
Species: Hu
Applications: WB, IHC-P, IP, PLA
H00079075-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IF
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89091
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001663-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF2147
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-55120
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2535
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-03414
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB2878
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30490
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF

Publications for CHTF8 Antibody (NBP2-30490) (0)

There are no publications for CHTF8 Antibody (NBP2-30490).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHTF8 Antibody (NBP2-30490) (0)

There are no reviews for CHTF8 Antibody (NBP2-30490). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CHTF8 Antibody (NBP2-30490) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHTF8 Products

Bioinformatics Tool for CHTF8 Antibody (NBP2-30490)

Discover related pathways, diseases and genes to CHTF8 Antibody (NBP2-30490). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHTF8 Antibody (NBP2-30490)

Discover more about diseases related to CHTF8 Antibody (NBP2-30490).
 

Pathways for CHTF8 Antibody (NBP2-30490)

View related products by pathway.

Blogs on CHTF8

There are no specific blogs for CHTF8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHTF8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHTF8
Uniprot