CHTF8 Antibody - BSA Free

Western Blot: CHTF8 Antibody [NBP2-30490] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: CHTF8 Antibody [NBP2-30490] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CHTF8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CHTF8 Antibody - BSA Free (NBP2-30490) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PIGPNSAHFSRPVGPMGVNANPFPRGAGSSAFSQSSGTLASNPATFQRSAGLQGSNPTIFPRASGPLGPNPANFPRAT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHTF8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CHTF8 Protein (NBP2-30490PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CHTF8 Antibody - BSA Free

• chromosome transmission fidelity protein 8 homolog
• CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae)
• CTF8hCTF8
• Decreased expression in renal and prostate cancer protein
• DERPCchromosome transmission fidelity factor 8 homolog
• FLJ20400

Background

CHTF8 encodes a short protein that forms part of the Ctf18 replication factor C (RFC) complex that occurs in both yeast and mammals. The heteroheptameric RFC complex plays a role in sister chromatid cohesion and may load the replication clamp PCNA (proliferating cell nuclear antigen) onto DNA during DNA replication and repair. This gene is ubiquitously expressed and has been shown to have reduced expression in renal and prostate tumors. Alternative splicing results in multiple variants encoding different isoforms. This gene has a pseudogene on chromosome X. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longest transcript. Variants 1 and 4 encode the same isoform (A).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHTF8
• Uniprot:
  • P0CG13(Human)