CHT1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit CHT1 Antibody - BSA Free (NBP2-86604) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human CHT1. Peptide sequence: ILVKNENIKLDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNL The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLC5A7 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for CHT1 Antibody - BSA Free
Background
Acetylcholine functions as a neurotransmitter in both the central and peripheral nervous systems of all vertebates, and is the principle neurotransmitter used at the neuromuscular junction. Presynaptic synthesis of acetylcholine requires a steady supply of choline, which is acquired by a plasma membrane high affinity choline transporter (CHT). CHT1 is a plasmalemmal transporter that carries choline to acetylcholine-synthesizing neurons.
CHT1 antibodies are useful tools for neruology and cell signaling studies.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: EM, ELISA, Flow, ICC/IF, IHC, WB
Species: Hu
Applications: Flow, IHC, mIF
Species: Hu
Applications: IP (-), WB
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: WB
Publications for CHT1 Antibody (NBP2-86604) (0)
There are no publications for CHT1 Antibody (NBP2-86604).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CHT1 Antibody (NBP2-86604) (0)
There are no reviews for CHT1 Antibody (NBP2-86604).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CHT1 Antibody (NBP2-86604) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CHT1 Products
Research Areas for CHT1 Antibody (NBP2-86604)
Find related products by research area.
|
Blogs on CHT1