CHT1 Antibody - BSA Free

Western Blot: CHT1 Antibody [NBP2-86604] - Host: Rabbit. Target Name: SLC5A7. Sample Type: ACHN Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CHT1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CHT1 Antibody - BSA Free (NBP2-86604) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human CHT1. Peptide sequence: ILVKNENIKLDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC5A7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CHT1 Antibody - BSA Free

• CHT
• CHT1MGC126299
• hCHT
• Hemicholinium-3-sensitive choline transporter
• high affinity choline transporter 1
• high affinity choline transporter; hemicholinium-3-sensitive cholinetransporter
• MGC126300
• solute carrier family 5 (choline transporter), member 7
• Solute carrier family 5 member 7

Background

Acetylcholine functions as a neurotransmitter in both the central and peripheral nervous systems of all vertebates, and is the principle neurotransmitter used at the neuromuscular junction. Presynaptic synthesis of acetylcholine requires a steady supply of choline, which is acquired by a plasma membrane high affinity choline transporter (CHT). CHT1 is a plasmalemmal transporter that carries choline to acetylcholine-synthesizing neurons.

CHT1 antibodies are useful tools for neruology and cell signaling studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC5A7