CHST14 Antibody

Images

 
Western Blot: CHST14 Antibody [NBP1-55174] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, CaSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHST14 Antibody Summary

Immunogen
Synthetic peptides corresponding to CHST14(carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14) The peptide sequence was selected from the middle region of CHST14. Peptide sequence REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHW
Predicted Species
Mouse (100%), Rat (100%), Porcine (100%), Bovine (100%), Canine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHST14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CHST14 and was validated on Western blot.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CHST14 Antibody

  • ATCS
  • carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14
  • D4ST-1
  • D4ST1carbohydrate sulfotransferase 14
  • dermatan 4 sulfotransferase 1
  • Dermatan 4-sulfotransferase 1
  • EC 2.8.2.-
  • HD4ST
  • hD4ST1
  • HNK1ST

Background

CHST14 belongs to the sulfotransferase 2 family. CHST14 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. It transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. It transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA-sequences. CHST14 has preference for partially desulfated dermatan sulfate. Addition of sulfate to GalNAc may occur immediately after epimerization of GlcUA to IdoUA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: IHC, IHC-P
NBP2-30481
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB100-104
Species: Hu, Mu, Rt, Ca, Ma
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-48736
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2567
Species: Mu
Applications: WB, IHC
NB110-8146
Species: Hu, Po, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-55174
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB

Publications for CHST14 Antibody (NBP1-55174) (0)

There are no publications for CHST14 Antibody (NBP1-55174).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHST14 Antibody (NBP1-55174) (0)

There are no reviews for CHST14 Antibody (NBP1-55174). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHST14 Antibody (NBP1-55174) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CHST14 Products

Bioinformatics Tool for CHST14 Antibody (NBP1-55174)

Discover related pathways, diseases and genes to CHST14 Antibody (NBP1-55174). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHST14 Antibody (NBP1-55174)

Discover more about diseases related to CHST14 Antibody (NBP1-55174).
 

Pathways for CHST14 Antibody (NBP1-55174)

View related products by pathway.

PTMs for CHST14 Antibody (NBP1-55174)

Learn more about PTMs related to CHST14 Antibody (NBP1-55174).
 

Research Areas for CHST14 Antibody (NBP1-55174)

Find related products by research area.

Blogs on CHST14

There are no specific blogs for CHST14, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHST14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHST14