CHIP/STUB1 Antibody (2E12) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse CHIP/STUB1 Antibody (2E12) - Azide and BSA Free (H00010273-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
STUB1 (NP_005852.2, 204 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY |
| Specificity |
Reacts with STIP1 homology and U-box containing protein 1. |
| Isotype |
IgG2a Lambda |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
STUB1 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot
|
| Application Notes |
This antibody is reactive against recombinant protein in western blot and ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CHIP/STUB1 Antibody (2E12) - Azide and BSA Free
Background
STUB1, or CHIP, is a ubiquitin ligase/cochaperone that participates in protein quality control by targeting a broad range of chaperone protein substrates for degradation (Min et al., 2008 [PubMed 18411298]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: BA
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Publications for CHIP/STUB1 Antibody (H00010273-M01) (0)
There are no publications for CHIP/STUB1 Antibody (H00010273-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CHIP/STUB1 Antibody (H00010273-M01) (0)
There are no reviews for CHIP/STUB1 Antibody (H00010273-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CHIP/STUB1 Antibody (H00010273-M01). (Showing 1 - 1 of 1 FAQ).
-
I am interested in a monoclonal antibody for Stub1 protein (CHIP). I need the antibody for a structural characterization, so it's very important for me to know the reactive sequence. It would be great if you can give me information about what is the reactive domain (TPR or U-box).
- You are right to identify CHIP Antibody (2E12) (H00010273-M01) - this is our only monoclonal antibody for STUB1/CHIP. The immunogen sequence for H00010273-M01 is amino acids 204-303 of the canonical sequence (isoform 1) as described in UniProt (http://www.uniprot.org/uniprot/Q9UNE7). According to this UniProt page (the 'Regions' section), this corresponds to the U-box domain, with some amino acids either side, but not overlapping with a TPR repeat.
Secondary Antibodies
| |
Isotype Controls
|
Additional CHIP/STUB1 Products
Research Areas for CHIP/STUB1 Antibody (H00010273-M01)
Find related products by research area.
|
Blogs on CHIP/STUB1