CHD9 Recombinant Protein Antigen

Images

 
There are currently no images for CHD9 Recombinant Protein Antigen (NBP3-17228PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CHD9 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHD9

Source: E. coli

Amino Acid Sequence: SLRSQQNRNNLNPGQNSLSQSKNFMNVSGPHRVNVNHPPQMTNASNSQQSISMQQFSQTSNPSAHFHKCSSHQEGNFNGPSPNMTSCSVSNSQQFSSHYSFSSNHISPNSLLQSSA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CHD9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17228.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CHD9 Recombinant Protein Antigen

  • AD013
  • ATP-dependent helicase CHD9
  • BC022889
  • CHD-9
  • chromatin remodeling factor CHROM1
  • Chromatin-related mesenchymal modulator
  • Chromatin-remodeling factor CHROM1
  • chromodomain helicase DNA binding protein 9
  • chromodomain-helicase-DNA-binding protein 9
  • ciprofibrate bound protein p240
  • CReMM
  • EC 3.6.1
  • EC 3.6.4.12
  • FLJ12178
  • KIAA0308
  • KISH2
  • Kismet homolog 2
  • Peroxisomal proliferator-activated receptor A-interacting complex 320 kDaprotein
  • PPAR{gamma}-interacting cofactor 320 kDa
  • PPAR-alpha-interacting complex protein 320 kDa
  • PRIC320
  • proteinx0008

Background

CHD9/CReMM is a member of the CHD (chromodomain-helicase-DNA-binding) family of proteins that interacts with nucleosomes and plays a role in chromatin remodeling to modulate transcription. The members of the CHD family of proteins possess 3 common structural and functional domains: a chromodomain (chromatin organization modifier), an SNF2-like helicase/ATPase domain, and a C-terminal DNA-binding domain. CHD9/CReMM is thought to play a role in development due to its role in tissue-specific gene transcription. CHD9/CReMM also functions as a PPARA transcriptional coactivator. Alternate names for CHD9/CreMM include chromodomain-helicase-DNA-binding protein 9, ATP-dependent helicase CHD9, chromatin-related mesenchymal modulator, chromatin-remodeling factor CHROM1, PPARA-interacting complex 320 kDa protein, kismet homolog 2, KIAA0308, KISH2, AD013, and PRIC320.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF5738
Species: Hu
Applications: ICC, KO, Simple Western, WB
NBP3-13283
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
AF2667
Species: Hu
Applications: IHC, WB
4014-SP
Species: Hu
Applications: BA
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
MAB1167
Species: Hu
Applications: Neut, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
314-BP
Species: Hu
Applications: BA, BA
NB100-56605
Species: Av, Bv, Sh
Applications: WB
AF942
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-01860
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-37003
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA
H00009242-M01
Species: Hu
Applications: ELISA, WB
NB100-563
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-07505
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-17228PEP
Species: Hu
Applications: AC

Publications for CHD9 Recombinant Protein Antigen (NBP3-17228PEP) (0)

There are no publications for CHD9 Recombinant Protein Antigen (NBP3-17228PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHD9 Recombinant Protein Antigen (NBP3-17228PEP) (0)

There are no reviews for CHD9 Recombinant Protein Antigen (NBP3-17228PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CHD9 Recombinant Protein Antigen (NBP3-17228PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CHD9 Products

Array NBP3-17228PEP

Blogs on CHD9

There are no specific blogs for CHD9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CHD9 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CHD9