CHD8 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CHD8 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHD8.

  Source: E. coli

  Amino Acid Sequence: PEFAVDPRFLAYMEDRRKQKWQRCKKNNKAELNCLGMEPVQTANSRNGKKGHHTETVFNRVLPGPIAPESSKKRARRMRPDLSKMMALMQGGSTGSLSLHNTFQHSSSGLQSVSSLGHSSATSASLPFMPFVMGGAPSSPHVD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CHD8
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58582.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CHD8 Recombinant Protein Antigen

• ATP-dependent helicase CHD8
• CHD-8
• chromodomain helicase DNA binding protein 8
• DKFZp686N17164
• duplin
• EC 3.6.1
• EC 3.6.1.7
• EC 3.6.4.12
• Helicase with SNF2 domain 1chromodomain-helicase-DNA-binding protein 8
• HELSNF1
• KIAA1564axis duplication inhibitor

Background

CHD8 is a member of the CHD (chromodomain-helicase-DNA-binding) family of proteins that interacts with nucleosomes and plays a role in chromatin remodeling to modulate transcription. The members of the CHD family of proteins possess 3 common structural and functional domains: a chromodomain (chromatin organization modifier), an SNF2-like helicase/ATPase domain, and a C-terminal DNA-binding domain. CHD8 has been reported to interact with duplin, a protein involved in the wnt signaling pathway, and CTCF, a protein involved in heterochromatin formation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for CHD8 Recombinant Protein Antigen (NBP2-58582PEP). (Showing 1 - 1 of 1 FAQ).

1. I see that all of your CHD8 antibodies say that they are specific for human. Have any been tested in mouse? I want to know if they have and were found not to be suitable. Ideally, I would like to try one in mouse for immunocytochemistry.
   • We have not tested any of our CHD8 antibodies in mouse samples, and do not have any data to support whether they will work for you or not. If you would like to purchase one to try on your samples, you will qualify for our Innovators Reward Program. Under this program, Novus will provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal value in exchange for your new data.

Bioinformatics

• Gene Symbol: CHD8