CHD1L Antibody - BSA Free

Western Blot: CHD1L Antibody [NBP1-89153] - Analysis using Anti-CHD1L antibody NBP1-89153 (A) shows similar pattern to independent antibody NBP1-89154 (B).

Immunocytochemistry/Immunofluorescence: CHD1L Antibody [NBP1-89153] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: CHD1L Antibody [NBP1-89153] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: CHD1L Antibody [NBP1-89153] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: CHD1L Antibody [NBP1-89153] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CHD1L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CHD1L Antibody - BSA Free (NBP1-89153) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-CHD1L Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTLLEKASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKRQEAAAKRRRLIEEKKR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHD1L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CHD1L Protein (NBP1-89153PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CHD1L Antibody - BSA Free

• ALC1
• amplified in liver cancer 1
• amplified in liver cancer protein 1
• CHD1L
• CHDL
• chromodomain helicase DNA binding protein 1-like
• chromodomain-helicase-DNA-binding protein 1-like
• FLJ22530

Background

In response to DNA strand breaks, chromatin adopts a relaxed structure due to the addition of poly(ADP-ribose) (PAR) to chromatin proteins by PARP enzymes (see PARP1; MIM 173870), and this relaxation facilitates the repair of DNA damage. CHD1L interacts with PAR and has a role in chromatin relaxation following DNA damage (Ahel et al., 2009 (PubMed 19661379)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CHD1L Antibody (NBP1-89153)(1)

Publication using NBP1-89153

• Brockschmidt A, Chung B, Weber S et al. CHD1L: a new candidate gene for congenital anomalies of the kidneys and urinary tract (CAKUT). Nephrol Dial Transplant 2012-06-01 [PMID: 22146311]

Bioinformatics

• Gene Symbol: CHD1L