CHD1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CHD1 Antibody [NBP2-14478] - Staining of human cell line RH-30 shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: CHD1 Antibody [NBP2-14478] - Staining in human testis and skeletal muscle tissues.. Corresponding CHD1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CHD1 Antibody [NBP2-14478] - Staining of human placenta shows moderate to strong nuclear positivity.

Immunohistochemistry-Paraffin: CHD1 Antibody [NBP2-14478] - Staining of human endometrium shows weak to moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: CHD1 Antibody [NBP2-14478] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: CHD1 Antibody [NBP2-14478] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.

ChIP-Exo-Seq composite graph for Anti-CHD1 (NBP2-14478) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CHD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CHD1 Antibody - BSA Free (NBP2-14478) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: QESQQNSDQNSNLNPHVIRNPDVERLKENTNHDDSSRDSYSSDRHLTQYHDHHKDRHQGDSYKKSDSRKRPYSSFSNGKDHRDWDHYKQDSRYYSDREKHRKLDDHRSRDHRSNLEGSL
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CHD1 Protein (NBP2-14478PEP)

Reactivity Notes

Rat (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CHD1 Antibody - BSA Free

• ATP-dependent helicase CHD1
• CHD1
• CHD-1
• chromodomain helicase DNA binding protein 1
• chromodomain-helicase-DNA-binding protein 1
• DKFZp686E2337
• EC 3.6.1
• EC 3.6.4.12

Background

The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHD1