CHCHD3 Antibody

Images

 
Western Blot: CHCHD3 Antibody [NBP1-83656] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: CHCHD3 Antibody [NBP1-83656] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656] - Staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.
Western Blot: CHCHD3 Antibody [NBP1-83656] - Analysis in human cell line HEK 293.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHCHD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKRLKQAK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHCHD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CHCHD3 Protein (NBP1-83656PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-83656 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHCHD3 Antibody

  • coiled-coil-helix-coiled-coil-helix domain containing 3
  • FLJ20420
  • mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1919
Species: Hu, Mu, Rt, Ca, Fe
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84509
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-91779
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NBP1-87741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45464
Species: Hu
Applications: WB, IHC
NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33737
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87034
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-695
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
H00055735-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-78446
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-83537
Species: Hu
Applications: IHC, IHC-P
NBP1-91003
Species: Hu, Tr
Applications: IHC, IHC-P
NBP1-83656
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CHCHD3 Antibody (NBP1-83656) (0)

There are no publications for CHCHD3 Antibody (NBP1-83656).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for CHCHD3 Antibody (NBP1-83656) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-83656:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot CHCHD3 NBP1-83656
Enlarge
reviewed by:
Kathleen Emanuel
WB Human 06/15/2016
View

Summary

ApplicationWestern Blot
Sample TestedProtein lysate from mitochondria isolated from SH-SY5Y cells
SpeciesHuman
LotA96832

Blocking

Blocking DetailsSuperBlock : 15 minutes : Room Temperature

Primary Anitbody

Dilution Ratio1:500, 4 degree C, Overnight, 1:8 Superblock: TBST

Secondary Antibody

Secondary DescriptionLicor IR Dye 800 Goat anti-rabbit
Secondary Manufacturer Cat#(Product # 926-32211)
Secondary Concentration1:20000

Details

Detection NotesLicor Odyssey, Fluorescent labeling (No exposure needed)

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CHCHD3 Antibody (NBP1-83656) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHCHD3 Products

Bioinformatics Tool for CHCHD3 Antibody (NBP1-83656)

Discover related pathways, diseases and genes to CHCHD3 Antibody (NBP1-83656). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHCHD3 Antibody (NBP1-83656)

Discover more about diseases related to CHCHD3 Antibody (NBP1-83656).
 

Pathways for CHCHD3 Antibody (NBP1-83656)

View related products by pathway.

PTMs for CHCHD3 Antibody (NBP1-83656)

Learn more about PTMs related to CHCHD3 Antibody (NBP1-83656).

Blogs on CHCHD3

There are no specific blogs for CHCHD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Kathleen Emanuel
06/15/2016
Application: WB
Species: Human

Bioinformatics

Gene Symbol CHCHD3