CGI-128 Antibody

Images

 
Western Blot: CGI-128 Antibody [NBP1-88091] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: CGI-128 Antibody [NBP1-88091] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: CGI-128 Antibody [NBP1-88091] - Staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CGI-128 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LIYQRSGERPVTAGEEDEQVPDSIDAREIFDLIRSINDPEHPLTLEELNVVEQVRVQVSDPESTVAVAFTPTIP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM96B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CGI-128 Protein (NBP1-88091PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CGI-128 Antibody

  • CGI-128
  • family with sequence similarity 96, member B
  • MIP18
  • mitotic spindle-associated MMXD complex subunit MIP18
  • MSS19-interacting protein of 18 kDa
  • Protein FAM96B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47371
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84474
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3296
Species: Hu, Mu, Rt
Applications: WB
NBP1-83611
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
AF6349
Species: Hu, Mu, Rt
Applications: WB
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB5657
Species: Hu
Applications: WB, IP, ICC
NBL1-11392
Species: Hu
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
AF7384
Species: Hu
Applications: ICC
NB100-1077
Species: Hu
Applications: WB, PEP-ELISA
NBP1-33009
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88091
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CGI-128 Antibody (NBP1-88091) (0)

There are no publications for CGI-128 Antibody (NBP1-88091).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CGI-128 Antibody (NBP1-88091) (0)

There are no reviews for CGI-128 Antibody (NBP1-88091). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CGI-128 Antibody (NBP1-88091) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CGI-128 Products

Bioinformatics Tool for CGI-128 Antibody (NBP1-88091)

Discover related pathways, diseases and genes to CGI-128 Antibody (NBP1-88091). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CGI-128 Antibody (NBP1-88091)

Discover more about diseases related to CGI-128 Antibody (NBP1-88091).
 

Pathways for CGI-128 Antibody (NBP1-88091)

View related products by pathway.

Blogs on CGI-128

There are no specific blogs for CGI-128, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CGI-128 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM96B