Centaurin alpha 1 Antibody

Images

 
Western Blot: Centaurin alpha 1 Antibody [NBP1-88097] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-120
Immunocytochemistry/ Immunofluorescence: Centaurin alpha 1 Antibody [NBP1-88097] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Centaurin alpha 1 Antibody [NBP1-88097] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal and glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Centaurin alpha 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVAAFQKAVDRPMLPQEYAVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Centaurin alpha 1 Protein (NBP1-88097PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Centaurin alpha 1 Antibody

  • arf-GAP with dual PH domain-containing protein 1
  • ArfGAP with dual PH domains 1
  • CENTA1centaurin-alpha-1
  • centaurin, alpha 1
  • centaurin-alpha
  • Centaurin-alpha-1
  • cnt-a1
  • GCS1L
  • p42IP4
  • Putative MAPK-activating protein PM25

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP2-32482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91214
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88792
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-81134
Species: Hu
Applications: IHC, IHC-P
NB100-1319
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
640-A3
Species: Mu
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-88097
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Centaurin alpha 1 Antibody (NBP1-88097) (0)

There are no publications for Centaurin alpha 1 Antibody (NBP1-88097).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Centaurin alpha 1 Antibody (NBP1-88097) (0)

There are no reviews for Centaurin alpha 1 Antibody (NBP1-88097). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Centaurin alpha 1 Antibody (NBP1-88097) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Centaurin alpha 1 Products

Bioinformatics Tool for Centaurin alpha 1 Antibody (NBP1-88097)

Discover related pathways, diseases and genes to Centaurin alpha 1 Antibody (NBP1-88097). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Centaurin alpha 1 Antibody (NBP1-88097)

Discover more about diseases related to Centaurin alpha 1 Antibody (NBP1-88097).
 

Pathways for Centaurin alpha 1 Antibody (NBP1-88097)

View related products by pathway.

PTMs for Centaurin alpha 1 Antibody (NBP1-88097)

Learn more about PTMs related to Centaurin alpha 1 Antibody (NBP1-88097).
 

Research Areas for Centaurin alpha 1 Antibody (NBP1-88097)

Find related products by research area.

Blogs on Centaurin alpha 1

There are no specific blogs for Centaurin alpha 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Centaurin alpha 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAP1