Centaurin alpha 1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Centaurin alpha 1 Antibody [NBP1-88097] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.

Immunohistochemistry-Paraffin: Centaurin alpha 1 Antibody [NBP1-88097] - Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: Centaurin alpha 1 Antibody [NBP1-88097] - Staining of human Cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: Centaurin alpha 1 Antibody [NBP1-88097] - Staining of human Cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: Centaurin alpha 1 Antibody [NBP1-88097] - Staining of human Stomach shows strong cytoplasmic positivity in glandular cells.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Centaurin alpha 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Centaurin alpha 1 Antibody - BSA Free (NBP1-88097) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PKQTEGFRKRWFTMDDRRLMYFKDPLDAFARGEVFIGSKESGYTVLHGFPPSTQGHHWPHGITIVTPDRKFLFACETESDQREWVAAFQKAVDRPMLPQEYAVE
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Centaurin alpha 1 Protein (NBP1-88097PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Centaurin alpha 1 Antibody - BSA Free

• arf-GAP with dual PH domain-containing protein 1
• ArfGAP with dual PH domains 1
• CENTA1centaurin-alpha-1
• centaurin, alpha 1
• centaurin-alpha
• Centaurin-alpha-1
• cnt-a1
• GCS1L
• p42IP4
• Putative MAPK-activating protein PM25

Background

The centaurin alpha 1 protein is a high affinity PtdIns(3,4,5)P3 binding protein enriched in brain. By acting as a GTPase activating protein for ADP ribosylation factor 6 (ARF6), centaurin alpha 1 is able to switch off ARF6 and inhibit its ability to mediate beta 2 adrenoceptor internalization and negatively regulates ARF6 activity by functioning as an in vivo PIP3 dependent ARF6 GAP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAP1