CENPV Antibody

Images

 
Western Blot: CENPV Antibody [NBP1-84545] - Analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: CENPV Antibody [NBP1-84545] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: CENPV Antibody [NBP1-84545] - Staining of human skin shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CENPV Antibody [NBP1-84545] - Staining in human testis and skin tissues using anti-CENPV antibody. Corresponding CENPV RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: CENPV Antibody [NBP1-84545] - Staining of human gastrointestinal shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: CENPV Antibody [NBP1-84545] - Staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CENPV Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NLDLGEQRERWETFQKRQKLTSEGAAKLLLDTFEYQGLVKHTGGCHCGAVRFEVWASADLHIFDCNCSICKKKQN
Specificity
Specificity of human CENPV antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CENPV
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CENPV Protein (NBP1-84545PEP)
Publications
Read Publication using NBP1-84545.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CENPV Antibody

  • 3110013H01Rik
  • CENP-VPRR6
  • centromere protein V
  • Nuclear protein p30
  • p30
  • proline rich 6
  • Proline-rich protein 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-91874
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-93562
Species: Hu
Applications: WB
H00057804-M01A
Species: Hu
Applications: WB, ELISA, S-ELISA
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
H00008878-M01
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
H00010963-M35
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-23000
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-13469
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for CENPV Antibody (NBP1-84545)(1)

Reviews for CENPV Antibody (NBP1-84545) (0)

There are no reviews for CENPV Antibody (NBP1-84545). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CENPV Antibody (NBP1-84545) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CENPV Products

Bioinformatics Tool for CENPV Antibody (NBP1-84545)

Discover related pathways, diseases and genes to CENPV Antibody (NBP1-84545). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CENPV Antibody (NBP1-84545)

Discover more about diseases related to CENPV Antibody (NBP1-84545).

Blogs on CENPV

There are no specific blogs for CENPV, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CENPV Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPV