CENPI Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CENPI Antibody [NBP2-56199] - Staining of human cell line U-2 OS shows localization to nuclear bodies & cytosol.

ChIP-Exo-Seq composite graph for Anti-CENPI (NBP2-56199) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CENPI Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CENPI Antibody - BSA Free (NBP2-56199) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PRNSKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKDKTLEKHLKTVENVAWKNGLASEEIDILLNIALSGKFGNAVN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CENPI
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CENPI Recombinant Protein Antigen (NBP2-56199PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CENPI Antibody - BSA Free

• CENP-IFSH primary response (LRPR1, rat) homolog 1
• centromere protein I
• Follicle-stimulating hormone primary response protein
• FSH primary response 1
• FSH primary response protein 1
• FSHPRH1Mis6
• ICEN19
• Interphase centromere complex protein 19
• Leucine-rich primary response protein 1
• LRPR1FSH primary response (LRPR1 homolog, rat) 1
• Mis6

Background

The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CENPI