CENPH Antibody - Azide and BSA Free

Western Blot: CENPH Antibody [H00064946-D01P] - Analysis of CENPH expression in mouse brain.

Western Blot: CENPH Antibody [H00064946-D01P] - Analysis of CENPH expression in PC-12.

Western Blot: CENPH Antibody [H00064946-D01P] - Analysis of CENPH expression in IMR-32.

Western Blot: CENPH Antibody [H00064946-D01P] - Analysis of CENPH expression in human liver.

Western Blot: CENPH Antibody [H00064946-D01P] - Analysis of CENPH expression in mouse kidney.

Western Blot: CENPH Antibody [H00064946-D01P] - Analysis of CENPH expression in transfected 293T cell line by CENPH polyclonal antibody.Lane 1: CENPH transfected lysate(27.28 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CENPH Antibody - Azide and BSA Free Summary

• Immunogen: CENPH (AAH12024, 1 a.a. - 247 a.a.) full-length human protein. MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM
• Specificity: CENPH - centromere protein H,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CENPH
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against tissue lysate and transfected lysate for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CENPH Antibody - Azide and BSA Free

• CENP-H
• centromere protein H
• ICEN35
• Interphase centromere complex protein 35
• kinetochore protein CENP-H
• NNF1
• PMF1

Background

Centromere and kinetochore proteins play a critical role in centromere structure, kinetochore formation, and sister chromatid separation. The protein encoded by this gene colocalizes with inner kinetochore plate proteins CENP-A and CENP-C in both interphase and metaphase. It localizes outside of centromeric heterochromatin, where CENP-B is localized, and inside the kinetochore corona, where CENP-E is localized during prometaphase. It is thought that this protein can bind to itself, as well as to CENP-A, CENP-B or CENP-C. Multimers of the protein localize constitutively to the inner kinetochore plate and play an important role in the organization and function of the active centromere-kinetochore complex. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CENPH
• Entrez:
  • 64946(Human)
• Uniprot:
  • AAH12024(Human)