Recombinant Human CENPF Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CENPF Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human CENPF partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CKSELERSQQAAQSADVSLNPCNTPQKIFTTPLTPSQYYSGSKYEDLKEKYNKEVEERKRLEAEVKALQAKKASQTLPQATMNHRDIARHQASSSVFSWQ

Protein/Peptide Type
Partial Recombinant Protein
Gene
CENPF

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CENPF Protein

  • AH antigen
  • cell-cycle-dependent 350K nuclear protein
  • CENF
  • CENP-F kinetochore protein
  • CENP-F
  • centromere protein F (350/400kD, mitosin)
  • centromere protein F
  • centromere protein F, 350/400ka (mitosin)
  • centromere protein F, 350/400kDa (mitosin)
  • hcp-1
  • Kinetochore protein CENPF
  • mitosin
  • PRO1779

Background

CENPF - centromere protein F, 350/400ka (mitosin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01086
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1844
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88089
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-06603
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00001063-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CENPF Partial Recombinant Protein (H00001063-Q01) (0)

There are no publications for CENPF Partial Recombinant Protein (H00001063-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENPF Partial Recombinant Protein (H00001063-Q01) (0)

There are no reviews for CENPF Partial Recombinant Protein (H00001063-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CENPF Partial Recombinant Protein (H00001063-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CENPF Products

CENPF H00001063-Q01

Bioinformatics Tool for CENPF Partial Recombinant Protein (H00001063-Q01)

Discover related pathways, diseases and genes to CENPF Partial Recombinant Protein (H00001063-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CENPF Partial Recombinant Protein (H00001063-Q01)

Discover more about diseases related to CENPF Partial Recombinant Protein (H00001063-Q01).
 

Pathways for CENPF Partial Recombinant Protein (H00001063-Q01)

View related products by pathway.

PTMs for CENPF Partial Recombinant Protein (H00001063-Q01)

Learn more about PTMs related to CENPF Partial Recombinant Protein (H00001063-Q01).
 

Research Areas for CENPF Partial Recombinant Protein (H00001063-Q01)

Find related products by research area.

Blogs on CENPF.

CENPF: At the Center-o'-mere Mitotic Division (Infographic)
Centromere protein F (CENPF) also known as Mitosin, AH antigen, and kinetochore protein CENPF, is a protein that associates with the centromere-kinetochore complex. CENPF forms both a homodimer and a heterodimer. CENPF can be found in different cellul...  Read full blog post.

CENPF Antibodies as Potential Cancer Markers
Centromere protein F (CENPF), also named mitosin, is a large human protein of 3113 amino acid residues. Its expression and localization are cell cycle-dependent. The protein levels are low in G1 phase but elevated from S to early M phase. CENPF is a n...  Read full blog post.

Customers Who Bought This Also Bought

CENPF Antibody
NB500-101

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CENPF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPF