Home » CEBP epsilon » CEBP epsilon Antibodies » CEBP epsilon Antibody (7A4)

CEBP epsilon Antibody (7A4)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: CEBP epsilon Antibody (7A4) [H00001053-M01] - Analysis of CEBPE expression in transfected 293T cell line by CEBPE monoclonal antibody (M01), clone 7A4.Lane 1: CEBPE transfected lysate(30.6 KDa).Lane 2: Non-transfected lysate.
Western Blot: CEBP epsilon Antibody (7A4) [H00001053-M01] - Analysis of CEBPE expression in transfected 293T cell line by CEBPE monoclonal antibody (M01), clone 7A4.Lane 1: CEBPE transfected lysate(30.6 KDa).Lane 2: ...read more
Western Blot: CEBP epsilon Antibody (7A4) [H00001053-M01] - Analysis of CEBPE over-expressed 293 cell line, cotransfected with CEBPE Validated Chimera RNAi ( Cat # H00001053-R01V ) (Lane 2) or non-transfected control ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, KD
Clone
7A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CEBP epsilon Antibody (7A4) Summary

Immunogen
CEBPE (AAH35797.2, 1 a.a. ~ 281 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
Specificity
CEBPE - CCAAT/enhancer binding protein (C/EBP), epsilon
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CEBPE
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Knockdown Validated
  • Western Blot 1:500RNAi Validation
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CEBP epsilon Antibody (7A4)

  • C/EBP-epsilon
  • CCAAT/enhancer binding protein (C/EBP), epsilon
  • CCAAT/enhancer-binding protein epsilon
  • CEBP epsilon
  • CEBPE
  • CRP1C/EBP epsilon

Background

The protein encoded by this gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal differentiation and functional maturation of committed granulocyte progenitor cells. Mutations in this gene have been associated with Specific Granule Deficiency, a rare congenital disorder. Multiple variants of this gene have been described, but the full-length nature of only one has been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CSRP1 Antibody
AF5739
Western blot shows lysates of ME-180 human cervical epithelial carcinoma cell line, HT-2 mouse T cell line, and Rat-2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL Goat Anti-Human/Mouse/Rat CSRP1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5739) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). For additional reference, recombinant human CSRP1, CSRP2, CSRP3 (5 ng/lane) were included. A specific band for CSRP1 was detected at approximately 23 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: WB
CEBP Beta Antibody
(SC55-05)
NBP2-67635
Flow Cytometry: CEBP Beta Antibody (SC55-05) [NBP2-67635] - Analysis of Hela cells with C/EBP Beta antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: CEBP Beta Antibody (SC55-05) [NBP2-67635] - Staining C/EBP Beta in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: CEBP Beta Antibody (SC55-05) [NBP2-67635] - Staining C/EBP Beta in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IP, WB
CSRP2 Antibody
NB100-77341
Immunohistochemistry-Paraffin: CSRP2 Antibody [NB100-77341] - Analysis of Human Lung. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: CSRP2 Antibody [NB100-77341] - HEK293 overexpressing CRP2 and probed with (mock transfection in first lane).
Western Blot: CSRP2 Antibody [NB100-77341] - Analysis of Human (A), Mouse (B) and Rat (C) Kidney lysates (35ug protein in RIPA buffer).
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
CEBP Delta Antibody
NB110-85519
Western Blot: CEBP Delta Antibody [NB110-85519] - Lane 1: untreated wild-type (WT) cells. Lane 2: WT cells treated 3 hrs with LPS. Lane 3: C/EBPd-knock-out cells treated 3 hrs with LPS. 35 ug per lane. Primary: anti-C/EBPd antibody at 1:15k overnight at 4C. Blocking: buffer TBST ECL was used for detection of endogenous protein in whole cell extracts from mouse primary macrophage cells. Predicted/Observed size: 28.8 kDa, 35 kDa.
Western Blot: CEBP Delta Antibody [NB110-85519] - Lane 1: Human C/EBPbeta. Lane 2: Mouse C/EBPdelta. Lane 3: untransfected. Lane 4: Human C/EBPdelta. 35 ug per lane. Primary: Anti-C/EBPd antibody at 1:15k overnight at 4C. Blocking: buffer TBST ECL was used for detection of overexpressed protein in human and mouse C/EBP delta. Predicted/Observed size: 28.8 kDa, 35 kDa.
Western Blot: CEBP Delta Antibody [NB110-85519] - Detection of endogenous protein in whole cell extracts from mouse macrophage cells. Untreated WT cells (Lane 1), WT cells treated 3 hrs with LPS (Lane 2) and knock-out cells treated 3 hrs with LPS (Lane 3). The band at ~35 kDa, indicated by the arrowhead, corresponds to the expected molecular weight of endogenous C/EBP delta. Primary antibody at 1:15,000. ECL was used for detection.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IP, KD, WB
CRIP2 Antibody
NBP2-16012
Immunohistochemistry-Paraffin: CRIP2 Antibody [NBP2-16012] - Paraffin-embedded lung adenocarcinoma blood vessel. CRIP2 antibody [N1C3-2] dilution: 1:500.
Western Blot: CRIP2 Antibody [NBP2-16012] - Sample (30 ug of whole cell lysate) A: Hela 12% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: CRIP2 Antibody [NBP2-16012] - Immunofluorescence analysis of methanol-fixed HeLa, using antibody at 1:200 dilution.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
C-Reactive
Protein/CRP [HRP]
DCRP00
(4 Reviews)
(117 Publications)
Species: Hu
Applications: ELISA

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GLB1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of Carcinoma of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of Human liver tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
(7 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
SH3D19 Antibody
(5C7)
H00152503-M01
Immunocytochemistry/Immunofluorescence: SH3D19 Antibody (5C7) [H00152503-M01] - Analysis of monoclonal antibody to SH3D19 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: SH3D19 Antibody (5C7) [H00152503-M01] - Analysis of monoclonal antibody to SH3D19 on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 3 ug/ml.
Western Blot: SH3D19 Antibody (5C7) [H00152503-M01] - SH3D19 monoclonal antibody (M01), clone 5C7. Analysis of SH3D19 expression in Raw 264.7.
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
EBP Antibody
NBP1-85699
Immunocytochemistry/Immunofluorescence: EBP Antibody [NBP1-85699] - Staining of human cell line U-251 MG shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699] - Staining of human gastrointestinal shows weak granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CSRP3 Antibody
NBP1-06983
Western Blot: CSRP3 Antibody [NBP1-06983] - (0.01ug/ml) staining of Human (A), Mouse (B) and Rat (C) Heart lysate (35ug protein in RIPA buffer). Detected by chemiluminescence.
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP1-06983] - Staining of paraffin embedded Human Skeletal Muscle. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP1-06983] - staining of paraffin embedded Human Heart. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on Jurkat cells with c-Myc Antibody (9E10) NB600-302R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Western Blot: c-Myc Antibody (9E10) [NB600-302] - CtIP is phosphorylated by CDKs at multiple sites. Myc-BRCA1 and/or HA-CtIP WT or indicated mutants were expressed in 293T cells and co-immunoprecipitation was performed. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pgen.1003277) licensed under a CC-BY licence.
(4 Reviews)
(38 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
CDP/CUTL1 Antibody
(2A10)
H00001523-M01
Western Blot: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of CUX1 expression in transfected 293T cell line by CUTL1 monoclonal antibody (M01), clone 2A10.Lane 1: CUX1 transfected lysate(77.2 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - mouse cortex - postnatal brain was stained with anti-CUTL1 antibody. Image from verified customer review.
ELISA: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Detection limit for recombinant GST tagged CUTL1 is approximately 0.03ng/ml as a capture antibody.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
GATA-1 Antibody
(4F5)
NBP1-47492
Immunohistochemistry: GATA-1 Antibody (4F5) [NBP1-47492] - Staining of Fetal Baboon Liver. Antigen retrieval: 10mM sodium citrate, pH 6.0, Primary Ab: 1:500 dilution, Secondary Ab (biotinylated): 1:200, Streptavidin-AlexaFluor488: 1:500 (green), Quench autofluorescence with 1% Sudan Black in 70% methanol. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: GATA-1 Antibody (4F5) [NBP1-47492] - Analysis of K562(left) cells using GATA1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry-Paraffin: GATA-1 Antibody (4F5) [NBP1-47492] - Analysis of pancreatic cancer, using GATA1 mouse mAb with DAB staining.
(1 Review)
(2 Publications)
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
CD11b Antibody -
BSA Free
NB110-89474
Immunohistochemistry-Frozen: CD11b Antibody [NB110-89474] - Immunohistochemical analysis of frozen sections of mouse spleen using [NB110-89474]. IHC-Fr image submitted by a verified customer review.
Flow Cytometry: CD11b Antibody [NB110-89474] - A surface stain was performed on Raw264.7 cells with DyLight 550-conjugated [NB110-89474R] (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 10 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Immunohistochemistry: CD11b Antibody [NB110-89474] - Representative photomicrographs of cross sections of uteri collected from wild type (WT) mice 24 h after intrauterine infusion with 100 ul of vehicle or 100 ug ultrapure LPS from E. coli O111:B4, and Tlr4-/- mice similarly infused intrauterine with vehicle or LPS. Cross sections were stained with haematoxylin and eosin, and immunostained using a CD11b antibody for granulocytes (red) and DAPI for cell nuclei (white), and images collected at 10X magnification sections (C, F, I, L; bars = 200 um). At least 4 sections per animal and at least 4 fields per section were examined. Only WT mice infused with LPS show evidence of inflammation and accumulation of granulocytes in the endometrium. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0012906) licensed under a CC-BY licence.
(12 Reviews)
(78 Publications)
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Ikaros/IKZF1
Antibody [Unconjugate
AF4984
Western blot shows lysates of Nalm‑6 human Pre‑B acute lymphocytic leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Ikaros Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4984) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). Bands were detected for Ikaros (1-8 spice forms) at approximately 37 to 63 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Jurkat human acute T cell leukemia cell line treated with 50 ng/mL PMA and 200 ng/mL calcium ionomycin for 30 minutes was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Ikaros/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human Ikaros Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4984) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The VPAC promoter was detected by standard PCR.
Simple Western lane view shows lysates of Nalm‑6 human Pre-B acute lymphocytic leukemia cell line, loaded at 0.2 mg/mL. Specific bands were detected for Ikaros at approximately 63-77 kDa (as indicated) using 10 µg/mL of Goat Anti-Human Ikaros Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4984) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(2 Publications)
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
CRIP3 Antibody
NBP1-88762
Immunohistochemistry-Paraffin: CRIP3 Antibody [NBP1-88762] - Staining of human corpus, uterine shows moderate membranous and cytoplasmic positivity in glandular cells.
Western Blot: CRIP3 Antibody [NBP1-88762] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: CRIP3 Antibody [NBP1-88762] - Staining of human cell line U-2 OS shows localization to nuclear speckles. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PU.1/Spi-1 Antibody
NBP2-27163
Western Blot: PU.1/Spi1 Antibody [NBP2-27163] - analysis of 293T cell lysate (30ug) using anti-PU.1/Spi1 antibody. Image from verified customer review.
Western Blot: PU.1/Spi-1 Antibody [NBP2-27163] - PU.1/Spi1 Antibody [NBP2-27163] - Analysis of PU.1/Spi1 in U937 cell lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-27163.
Flow Cytometry: PU.1/Spi-1 Antibody [NBP2-27163] - PU.1/Spi1 Antibody [NBP2-27163] - Intracellular analysis of PU.1 in mouse RAW cells (top) and PMA treated (20 ng/ml, overnight) human ThP1 cells (bottom) using 1.25 ug/10^6 cells. Green peak represents isotype control this antibody ; red represents anti-PU.1 antibody.
(1 Review)
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
CEBP epsilon
Antibody (7A4)
H00001053-M01
CEBP epsilon Antibody (7A4)
Species: Hu
Applications: WB, ELISA, KD

Publications for CEBP epsilon Antibody (H00001053-M01) (0)

There are no publications for CEBP epsilon Antibody (H00001053-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEBP epsilon Antibody (H00001053-M01) (0)

There are no reviews for CEBP epsilon Antibody (H00001053-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CEBP epsilon Antibody (H00001053-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CEBP epsilon Products

Bioinformatics Tool for CEBP epsilon Antibody (H00001053-M01)

Discover related pathways, diseases and genes to CEBP epsilon Antibody (H00001053-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEBP epsilon Antibody (H00001053-M01)

Discover more about diseases related to CEBP epsilon Antibody (H00001053-M01).
 

Pathways for CEBP epsilon Antibody (H00001053-M01)

View related products by pathway.

PTMs for CEBP epsilon Antibody (H00001053-M01)

Learn more about PTMs related to CEBP epsilon Antibody (H00001053-M01).

Blogs on CEBP epsilon

There are no specific blogs for CEBP epsilon, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEBP epsilon Antibody (7A4) and receive a gift card or discount.


Bioinformatics

Gene Symbol CEBPE
Entrez
Uniprot