CEBP epsilon Antibody (7A4)

Images

 
Western Blot: CEBP epsilon Antibody (7A4) [H00001053-M01] - Analysis of CEBPE expression in transfected 293T cell line by CEBPE monoclonal antibody (M01), clone 7A4.Lane 1: CEBPE transfected lysate(30.6 KDa).Lane 2: ...read more
Western Blot: CEBP epsilon Antibody (7A4) [H00001053-M01] - Analysis of CEBPE over-expressed 293 cell line, cotransfected with CEBPE Validated Chimera RNAi ( Cat # H00001053-R01V ) (Lane 2) or non-transfected control ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, KD
Clone
7A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CEBP epsilon Antibody (7A4) Summary

Immunogen
CEBPE (AAH35797.2, 1 a.a. ~ 281 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
Specificity
CEBPE - CCAAT/enhancer binding protein (C/EBP), epsilon
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CEBPE
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Knockdown Validated
  • Western Blot 1:500RNAi Validation
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CEBP epsilon Antibody (7A4)

  • C/EBP-epsilon
  • CCAAT/enhancer binding protein (C/EBP), epsilon
  • CCAAT/enhancer-binding protein epsilon
  • CEBP epsilon
  • CEBPE
  • CRP1C/EBP epsilon

Background

The protein encoded by this gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta. The encoded protein may be essential for terminal differentiation and functional maturation of committed granulocyte progenitor cells. Mutations in this gene have been associated with Specific Granule Deficiency, a rare congenital disorder. Multiple variants of this gene have been described, but the full-length nature of only one has been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-67635
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IP, WB
NB100-77341
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NB110-85519
Species: Hu, Mu
Applications: ELISA, IHC, IP, KD, WB
NBP2-16012
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DCRP00
Species: Hu
Applications: ELISA
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
H00152503-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-85699
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-06983
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
AF4984
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
NBP1-88762
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-27163
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
H00001053-M01
Species: Hu
Applications: WB, ELISA, KD

Publications for CEBP epsilon Antibody (H00001053-M01) (0)

There are no publications for CEBP epsilon Antibody (H00001053-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEBP epsilon Antibody (H00001053-M01) (0)

There are no reviews for CEBP epsilon Antibody (H00001053-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CEBP epsilon Antibody (H00001053-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CEBP epsilon Products

Bioinformatics Tool for CEBP epsilon Antibody (H00001053-M01)

Discover related pathways, diseases and genes to CEBP epsilon Antibody (H00001053-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CEBP epsilon Antibody (H00001053-M01)

Discover more about diseases related to CEBP epsilon Antibody (H00001053-M01).
 

Pathways for CEBP epsilon Antibody (H00001053-M01)

View related products by pathway.

PTMs for CEBP epsilon Antibody (H00001053-M01)

Learn more about PTMs related to CEBP epsilon Antibody (H00001053-M01).

Blogs on CEBP epsilon

There are no specific blogs for CEBP epsilon, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CEBP epsilon Antibody (7A4) and receive a gift card or discount.

Bioinformatics

Gene Symbol CEBPE
Entrez
Uniprot