CEACAM5/CD66e Recombinant Protein Antigen

Images

 
There are currently no images for CEACAM5/CD66e Recombinant Protein Antigen (NBP1-85742PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CEACAM5/CD66e Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CEACAM5.

Source: E. coli

Amino Acid Sequence: QELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CEACAM5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85742. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CEACAM5/CD66e Recombinant Protein Antigen

  • Carcinoembryonic antigen
  • carcinoembryonic antigen-related cell adhesion molecule 5
  • CD66e antigen
  • CD66e
  • CEA
  • CEACAM5
  • CEACAM-5
  • CEACD66e
  • DKFZp781M2392
  • Meconium antigen 100

Background

The CD66e (CEA; 180-200 kDa) is a member of carcinoembryonic antigens, immunoglobulin supergene family and consists of a single N domain (structural homology to the immunoglobulin variable) and six immunoglobulin constant-like A (A1, A2, A3) and B domains (B1, B2, B3). Human CD66e is heavily glycosylated GPI anchored protein capable of both homophilic and heterophilic adhesion. Disease relevance: The CD66e may play a role in the process of metastasis of cancer cells. CD66e is found in serum and it is clinically used as a tumor marker for early detection of disease due to its expression in adenocarcinomas - potential target of tumor imaging and drug targeting.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
NBP1-83910
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NB110-58870
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
H00001434-M08
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-00532
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-687
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-84854
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
5609-MU
Species: Hu
Applications: Bind
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB3934
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
DKK300
Species: Hu
Applications: ELISA
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP2-45788
Species: Ce, Hu
Applications: IHC,  IHC-P, WB
NBP2-47940
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC,  IHC-P, Simple Western, WB

Publications for CEACAM5/CD66e Recombinant Protein Antigen (NBP1-85742PEP) (0)

There are no publications for CEACAM5/CD66e Recombinant Protein Antigen (NBP1-85742PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CEACAM5/CD66e Recombinant Protein Antigen (NBP1-85742PEP) (0)

There are no reviews for CEACAM5/CD66e Recombinant Protein Antigen (NBP1-85742PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CEACAM5/CD66e Recombinant Protein Antigen (NBP1-85742PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CEACAM5/CD66e Products

Research Areas for CEACAM5/CD66e Recombinant Protein Antigen (NBP1-85742PEP)

Find related products by research area.

Blogs on CEACAM5/CD66e

There are no specific blogs for CEACAM5/CD66e, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CEACAM5/CD66e Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CEACAM5