CEACAM5/CD66e Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CEACAM5/CD66e Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CEACAM5.
  
  

  Source: E. coli

  Amino Acid Sequence: QELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQN

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CEACAM5
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85742.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CEACAM5/CD66e Recombinant Protein Antigen

• Carcinoembryonic antigen
• carcinoembryonic antigen-related cell adhesion molecule 5
• CD66e antigen
• CD66e
• CEA
• CEACAM5
• CEACAM-5
• CEACD66e
• DKFZp781M2392
• Meconium antigen 100

Background

The CD66e (CEA; 180-200 kDa) is a member of carcinoembryonic antigens, immunoglobulin supergene family and consists of a single N domain (structural homology to the immunoglobulin variable) and six immunoglobulin constant-like A (A1, A2, A3) and B domains (B1, B2, B3). Human CD66e is heavily glycosylated GPI anchored protein capable of both homophilic and heterophilic adhesion. Disease relevance: The CD66e may play a role in the process of metastasis of cancer cells. CD66e is found in serum and it is clinically used as a tumor marker for early detection of disease due to its expression in adenocarcinomas - potential target of tumor imaging and drug targeting.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CEACAM5