CDKL2 Antibody - BSA Free

Western Blot: CDKL2 Antibody [NBP1-56376] - Titration: 0.2-1 ug/ml, Positive Control: SH-SY5Y cell lysate.

Product Discontinued

CDKL2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CDKL2(cyclin-dependent kinase-like 2 (CDC2-related kinase)) The peptide sequence was selected from the N terminal of CDKL2. Peptide sequence MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDKL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CDKL2 Antibody - BSA Free

• CDC2-related kinase
• CDKL2
• cyclin-dependent kinase-like 2 (CDC2-related kinase)
• cyclin-dependent kinase-like 2
• EC 2.7.11
• EC 2.7.11.22
• KKIAMRE
• p56 KKIAMRE protein kinase
• P56
• Protein kinase p56 KKIAMRE
• serine/threonine protein kinase KKIAMRE
• Serine/threonine-protein kinase KKIAMRE

Background

The specific function of the protein remains unknown.This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the cytoplasm, with lower levels in the nucleus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDKL2
• Uniprot:
  • Q92772(Human)