CDKL2 Antibody

Images

 
Western Blot: CDKL2 Antibody [NBP1-56376] - Titration: 0.2-1 ug/ml, Positive Control: SH-SYSY cell lysate.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDKL2 Antibody Summary

Immunogen
Synthetic peptides corresponding to CDKL2(cyclin-dependent kinase-like 2 (CDC2-related kinase)) The peptide sequence was selected from the N terminal of CDKL2. Peptide sequence MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDKL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CDKL2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CDKL2 Antibody

  • CDC2-related kinase
  • cyclin-dependent kinase-like 2 (CDC2-related kinase)
  • cyclin-dependent kinase-like 2
  • EC 2.7.11
  • EC 2.7.11.22
  • KKIAMRE
  • p56 KKIAMRE protein kinase
  • P56
  • Protein kinase p56 KKIAMRE
  • serine/threonine protein kinase KKIAMRE
  • Serine/threonine-protein kinase KKIAMRE

Background

The specific function of the protein remains unknown.This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the cytoplasm, with lower levels in the nucleus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7500
Species: Hu
Applications: WB, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-89747
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-67621
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF3206
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67811
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P, KO
NB100-77417
Species: Hu, Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for CDKL2 Antibody (NBP1-56376) (0)

There are no publications for CDKL2 Antibody (NBP1-56376).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDKL2 Antibody (NBP1-56376) (0)

There are no reviews for CDKL2 Antibody (NBP1-56376). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDKL2 Antibody (NBP1-56376) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CDKL2 Products

Bioinformatics Tool for CDKL2 Antibody (NBP1-56376)

Discover related pathways, diseases and genes to CDKL2 Antibody (NBP1-56376). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDKL2 Antibody (NBP1-56376)

Discover more about diseases related to CDKL2 Antibody (NBP1-56376).
 

Pathways for CDKL2 Antibody (NBP1-56376)

View related products by pathway.

PTMs for CDKL2 Antibody (NBP1-56376)

Learn more about PTMs related to CDKL2 Antibody (NBP1-56376).
 

Research Areas for CDKL2 Antibody (NBP1-56376)

Find related products by research area.

Blogs on CDKL2

There are no specific blogs for CDKL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDKL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDKL2
Uniprot