Home » CDKL2 » CDKL2 Antibodies » CDKL2 Antibody (6H8)

CDKL2 Antibody (6H8)

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: CDKL2 Antibody (6H8) [H00008999-M02] - Analysis of monoclonal antibody to CDKL2 on HeLa cell . Antibody concentration 10 ug/ml.
Immunocytochemistry/ Immunofluorescence: CDKL2 Antibody (6H8) [H00008999-M02] - Analysis of monoclonal antibody to CDKL2 on HeLa cell . Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
6H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CDKL2 Antibody (6H8) Summary

Immunogen
CDKL2 (NP_003939, 394 a.a. ~ 493 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LKDCSNVSVDHTRNPSVAIPPLTHNLSAVAPSINSGMGTETIPIQGYRVDEKTKKCSIPFVKPNRHSPSGIYNINVTTLVSGPPLSDDSGADLPQMEHQH
Localization
Cytoplasmic and Nuclear
Specificity
CDKL2 - cyclin-dependent kinase-like 2 (CDC2-related kinase)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDKL2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDKL2 Antibody (6H8)

  • CDC2-related kinase
  • CDKL2
  • cyclin-dependent kinase-like 2 (CDC2-related kinase)
  • cyclin-dependent kinase-like 2
  • EC 2.7.11
  • EC 2.7.11.22
  • KKIAMRE
  • p56 KKIAMRE protein kinase
  • P56
  • Protein kinase p56 KKIAMRE
  • serine/threonine protein kinase KKIAMRE
  • Serine/threonine-protein kinase KKIAMRE

Background

This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the cytoplasm, with lower levels in the nucleus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Lck [p Tyr394]
Antibody (755103)
MAB7500
Lck phosphorylated at Y394 was detected in immersion fixed Jurkat human acute T cell leukemia cells treated with (upper panel) or without (lower panel) Pervanadate using Mouse Anti-Human Phospho-Lck (Y394) Monoclonal Antibody (Catalog # MAB7500) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Western blot shows lysates of Jurkat human acute T cell leukemia cell line and Ramos human Burkitt's lymphoma cell line untreated (-) or treated (+) with 1 mM Pervanadate (PV) for 5 minutes. PVDF membrane was probed with 0.1 µg/mL of Mouse Anti-Human Phospho-Lck (Y394) Monoclonal Antibody (Catalog # MAB7500) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for Phospho-Lck (Y394) at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Publications)
Species: Hu
Applications: ICC, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
Flow Cytometry: CD4 Antibody [NBP1-19371] - An intracellular stain was performed on Jurkat cells with CD4 Antibody NBP1-19371R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
(9 Reviews)
(41 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Mouse CD3+ T Cell,
Small Column Enrichme ...
MTCC-10-NOV
Mouse CD3+ T Cell, Small Column Enrichment Kit
Species: Mu
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(4 Reviews)
(348 Publications)
Species: Hu
Applications: BA
ZAP70 Antibody
(3D2A4)
NB110-60490
Immunohistochemistry-Paraffin: ZAP70 Antibody (3D2A4) [NB110-60490] - Analysis of human lymph tumor, showing cytoplasmic localization using ZAP70 mouse mAb with DAB staining
Western Blot: ZAP70 Antibody (3D2A4) [NB110-60490] - Analysis using ZAP70 mouse mAb against Jurkat cell lysate (1).
(1 Publication)
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
GRASP55 Antibody
NBP1-89747
Immunocytochemistry/Immunofluorescence: GRASP55 Antibody [NBP1-89747] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.
Western Blot: GRASP55 Antibody [NBP1-89747] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GORASP2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: GRASP55 Antibody [NBP1-89747] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
(2 Reviews)
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
ILK Antibody (4F10)
H00003611-M01
Western Blot: ILK Antibody (4F10) [H00003611-M01] - Analysis of ILK expression in transfected 293T cell line by ILK monoclonal antibody (M01), clone 4F10.Lane 1: ILK transfected lysate(51.4 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: ILK Antibody (4F10) [H00003611-M01] - Analysis of monoclonal antibody to ILK on Jurkat cell . Antibody concentration 10 ug/ml.
Western Blot: ILK Antibody (4F10) [H00003611-M01] - Analysis of ILK over-expressed 293 cell line, cotransfected with ILK Validated Chimera RNAi ( Cat # H00003611-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ILK monoclonal antibody (M01) clone 4F10 (Cat # H00003611-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
Fyn Antibody
(FYN-01) - BSA Free
NB500-517
Immunoprecipitation: Fyn Antibody (FYN-01) [NB500-517] - Immunoprecipitation of Fyn from the lysate of T cells isolated from fresh buffy coats. Western blot was immunostained with anti-Fyn (FYN-01). Lane 1: original lysate of T cells Lane 2-3: Immunoprecipitated material eluted from affinity sorbent (FYN-01 coupled to Sepharose beads). Lanes differ in amount of T cell lysate loaded on the immunosorbent.
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in human primary fibroblasts using anti-Fyn (FYN-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in human HeLa cell line using anti-Fyn (FYN-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human colon using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(6 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - CD8 alpha expression in mouse spleen tissue using anti-CD8 alpha antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of bone marrow tissue by single and multiple staining.
Immunohistochemistry-Frozen: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of mosue spleen sections. CD8+ lymphocytes are marked by brown labeling of the cell surface.
(3 Reviews)
(20 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
ERK2 Antibody
(OTI6E5)
NBP1-47842
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Endometrium tissue within the normal limits using antiMAPK1mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min,Dilution 1:50)
Immunoprecipitation: ERK2 Antibody (6E5) [NBP1-47842] - TrueMab monoclonal anti-ERK2 antibody (Negative control: IP without adding anti-ERK2 antibody). For each experiment, 500ul of DDK tagged ERK2 overexpression lysates (at 1:5 dilution with HEK293T lysate), 2ug of antibody.
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-ERK2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Lyn Antibody
[Unconjugated]
AF3206
Western blot shows lysates of U937 human histiocytic lymphoma cell line, PT18 mouse mast/basophil cell line, and Y3‑Ag rat myeloid cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Lyn Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3206) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Lyn at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Nalm‑6 human Pre-B acute lymphocytic leukemia cell line, THP‑1 human acute monocytic leukemia cell line, Raji human Burkitt's lymphoma cell line, and Ramos human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Lyn at approximately 58-60 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Lyn Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3206) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Lyn was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) treated with monensin using Goat Anti-Human/Mouse/Rat Lyn Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3206) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
CDC2/CDK1 Antibody
NBP1-85729
Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody [NBP1-85729] - Staining in human tonsil and pancreas tissues . Corresponding CDK1 RNA-seq data are presented for the same tissues.
Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in human cell line A-431.
Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
p62/SQSTM1
Antibody (2C11)
H00008878-M01
Immunocytochemistry/Immunofluorescence: p62/SQSTM1 Antibody (2C11) [H00008878-M01] - Analysis of p62 in SH-SY5Y cells using anti-p62/SQSTM1 antibody. Red - p62 puncta; Blue - nuclear DAPI; Green - Cytoskeleton. Image from verified customer review.
Western Blot: p62/SQSTM1 Antibody (2C11) [H00008878-M01] - Confirmation of loss of hepatic ATG7 protein and a phenotype of hepatic autophagy inactivation. Fourth ug of liver protein were loaded on 4-20% gradient Tris-Glycine gels and subsequently immunoblotted with antibodies against ATG7, p62 and LC3. Blots were visualized with G:BOX Chemi XRQ (SynGene). Representative immunoblots are shown for WT and KO mice. Full-length immunoblots are presented in Supplementary Figure S1. ATG7: autophagy-related protein 7; p62: sequestosome 1; LC3: microtubule-associated protein 1 light chain 3; WT: Mx1-Cre-Atg7F/F mouse; KO: Mx1-Cre+Atg7F/F mouse. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-017-14405-w), licensed under a CC-BY licence.
Western Blot: p62/SQSTM1 Antibody (2C11) [H00008878-M01] - Disruption of the VANGL2-p62/SQSTM1 interaction in breast cancer cells. Soft agar colony formation of T47D cells overexpressing GFP, GFP-VANGL2 and GFP-p62/SQSTM1 (right). Protein expression was revealed with anti-p62/SQSTM1, anti-VANGL2 and anti-GFP antibodies by western blot analysis (right). In anti-GFP blot, the arrowhead indicates position of co-migrating GFP-VANGL2 and GFP-p62/SQSTM1 and the asterisk pinpoints GFP alone. Error bars represent mean+/-s.d. (n=3). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/ncomms10318), licensed under a CC-BY licence.
(9 Reviews)
(259 Publications)
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Cdk9 Antibody
(1C4E3)
NBP3-15345
Immunohistochemistry-Paraffin: Cdk9 Antibody (1C4E3) [NBP3-15345] - Immunohistochemistry of paraffin-embedded rat ovary using Cdk9 Rabbit mAb (NBP3-15345) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Cdk9 Antibody (1C4E3) [NBP3-15345] - Immunohistochemistry of paraffin-embedded human esophageal using Cdk9 Rabbit mAb (NBP3-15345) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Cdk9 Antibody (1C4E3) [NBP3-15345] - Immunohistochemistry of paraffin-embedded mouse brain using Cdk9 Rabbit mAb (NBP3-15345) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: CHIP-SEQ, ICC/IF, IHC, IHC-P, IP, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(16 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on Jurkat cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on HeLa cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U2-OS cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
CD45 Antibody
(30-F11) - BSA Free
NB100-77417
Immunohistochemistry-Paraffin: CD45 Antibody (30-F11) [NB100-77417] - Staining of a FFPE mouse liver tissue section using 1:100 dilution of CD45 antibody (30-F11) [NB100-77417]. Signal was detected using AF488 conjugated donkey anti-rat secondary antibody at 1:500 dilution. IHC-P image submitted by a verified customer review.
Immunohistochemistry: CD45 Antibody (30-F11) [NB100-77417] - Severe apoptosis and pathology in the orally infected heart. Experimental design is as outlined in Fig. 1B. Heart sections from moribund mice were examined with H&E, and immunohistochemistry staining for pan-leukocyte infiltration using an anti-CD45 antibody. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-47455-3), licensed under a CC-BY licence.
Immunohistochemistry: CD45 Antibody (30-F11) [NB100-77417] - Severe apoptosis and pathology in the orally infected heart. Experimental design is as outlined in Fig. 1B. Heart sections from moribund mice were examined with H&E, and immunohistochemistry staining for pan-leukocyte infiltration using an anti-CD45 antibody. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-47455-3), licensed under a CC-BY licence.
(5 Reviews)
(37 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western blot shows lysates of HEK293T human embryonic kidney cell line untreated (-) or treated (+) with 20 mJ/cm2 ultraviolet light (UV) with a 30 minute recovery. PVDF membrane was probed with 0.5 μg/mL of Rabbit Anti-Human Phospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-c‑Jun (S63) at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
c‑Junphosphorylated at S63 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line treated with Anisomycin using Rabbit Anti-HumanPhospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) at 1 μg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HEK293T human embryonic kidney cell line untreated (-) or treated (+) with 20 mJ/cm2 ultraviolet light (UV) with a 30 minute recovery, loaded at 0.2 mg/mL. A specific band was detected for Phospho-c‑Jun (S63) at approximately 49 kDa (as indicated) using 5 μg/mL of Rabbit Anti-Human Phospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for CDKL2 Antibody (H00008999-M02) (0)

There are no publications for CDKL2 Antibody (H00008999-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDKL2 Antibody (H00008999-M02) (0)

There are no reviews for CDKL2 Antibody (H00008999-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CDKL2 Antibody (H00008999-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDKL2 Products

Bioinformatics Tool for CDKL2 Antibody (H00008999-M02)

Discover related pathways, diseases and genes to CDKL2 Antibody (H00008999-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDKL2 Antibody (H00008999-M02)

Discover more about diseases related to CDKL2 Antibody (H00008999-M02).
 

Pathways for CDKL2 Antibody (H00008999-M02)

View related products by pathway.

PTMs for CDKL2 Antibody (H00008999-M02)

Learn more about PTMs related to CDKL2 Antibody (H00008999-M02).
 

Research Areas for CDKL2 Antibody (H00008999-M02)

Find related products by research area.

Blogs on CDKL2

There are no specific blogs for CDKL2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDKL2 Antibody (6H8) and receive a gift card or discount.


Bioinformatics

Gene Symbol CDKL2
Entrez
OMIM
Uniprot