CDK8 Antibody (2P3P8)

Western Blot: CDK8 Antibody (2P3P8) [NBP3-33454] - Western blot analysis of various lysates, using CDK8 Rabbit mAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clone: 2P3P8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CDK8 Antibody (2P3P8) Summary

• Description: Novus Biologicals Rabbit CDK8 Antibody (2P3P8) (NBP3-33454) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 364-464 of human CDK8 (NP_001251.1).
  
  Sequence:
  PDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CDK8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 53 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for CDK8 Antibody (2P3P8)

• CDK8 protein kinase
• CDK8
• Cell division protein kinase 8
• cyclin-dependent kinase 8
• EC 2.7.11
• EC 2.7.11.22
• EC 2.7.11.23
• K35
• Mediator complex subunit CDK8
• Mediator of RNA polymerase II transcription subunit CDK8
• MGC126074
• MGC126075
• Protein kinase K35

Background

Cdk8 is encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase and its regulatory subunit cyclin C are components of the RNA polymerase II holoenzyme complex, which phosphorylates the carboxy-terminal domain (CTD) of the largest subunit of RNA polymerase II. This kinase has also been shown to regulate transcription by targeting the CDK7/cyclin H subunits of the general transcription initiation factor IIH (TFIIH), thus providing a link between the 'Mediator-like' protein complexes and the basal transcription machinery.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDK8