CDCP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: CDCP1 Antibody [NBP1-85758] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: CDCP1 Antibody [NBP1-85758] - Staining of human duodenum shows strong membranous positivity in glandular cells.

Staining of human cervix shows weak to moderate membranous positivity in squamous epithelial cells.

Immunohistochemistry analysis in human duodenum and lymph node tissues using HPA010979 antibody. Corresponding CDCP1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CDCP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CDCP1 Antibody - BSA Free (NBP1-85758) is a polyclonal antibody validated for use in IHC. Anti-CDCP1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GFSIANRSSIKRLCIIESVFEGEGSATLMSANYPEGFPEDELMTWQFVVPAHLRASVSFLNFNLSNCERKEERVEYYIPGSTTNPEVFKLEDKQPGNMAGNFNLSLQGCDQDAQSPGILRLQFQVLVQHPQNESNKIYVVDLSNERA
• Predicted Species: Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDCP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CDCP1 Protein (NBP1-85758PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CDCP1 Antibody - BSA Free

• CD318 antigen
• CD318
• CDCP1
• CUB domain containing protein 1
• CUB domain-containing protein 1
• Membrane glycoprotein gp140
• SIMA135
• SIMA135TRASK
• Subtractive immunization M plus HEp3-associated 135 kDa protein
• Transmembrane and associated with src kinases

Background

CDCP1 is encoded by this gene is a transmembrane protein containing three extracellular CUB domains. This protein is found to be overexpressed in colon and lung cancers. Its expression level is correlated with the metastatic ability of carcinoma cells. This protein is located on the cell surface. It has been shown to be tyrosine phosphorylated in a cancer cell line. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CDCP1 Antibody (NBP1-85758)(1)

Publication using NBP1-85758

• Iwata M, Torok-Storb B, Wayner EA, Carter WG. CDCP1 Identifies a CD146 Negative Subset of Marrow Fibroblasts Involved with Cytokine Production. PLoS One 2014-01-01 [PMID: 25275584] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: CDCP1