CDC42EP1 Antibody (4P7S6)

Western Blot: CDC42EP1 Antibody (4P7S6) [NBP3-15881] - Western blot analysis of extracts of various cell lines, using CDC42EP1 Rabbit mAb (NBP3-15881) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Immunohistochemistry-Paraffin: CDC42EP1 Antibody (4P7S6) [NBP3-15881] - Immunohistochemistry of paraffin-embedded mouse heart using CDC42EP1 Rabbit mAb (NBP3-15881) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: CDC42EP1 Antibody (4P7S6) [NBP3-15881] - Immunohistochemistry of paraffin-embedded rat heart using CDC42EP1 Rabbit mAb (NBP3-15881) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 4P7S6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

CDC42EP1 Antibody (4P7S6) Summary

• Description: Novus Biologicals Rabbit CDC42EP1 Antibody (4P7S6) (NBP3-15881) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 292-391 of human CDC42EP1 (Q00587). AGLGPVAEVKSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CDC42EP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CDC42EP1 Antibody (4P7S6)

• Binder of Rho GTPases 5
• Borg5
• BORG5cdc42 effector protein 1
• CDC42 effector protein (Rho GTPase binding) 1
• CEP155 kDa bone marrow stromal/endothelial cell protein
• MSE55MGC15316
• serum constituent protein
• Serum protein MSE55

Background

CDC42EP1, also known as CDC42 Effector Protein 1, consists of a 40.2 kDa and 39.7 kDa isoform, and is involved in regulatory processes within the cell as a member of the Rho GTPase family. Most commonly found in bone marrow, the CDC42EP1 proteins been shown to help facilitate actin cytoskeleton restructuring and cell shape regulation. The protein is being studied for its involvement in osteonecrosis. The protein has been linked to the RhoA and Rho GTPases pathways where it interacts with MAPKAP1, RPTOR, RHOQ, CDC42, RBPMS, KRTAP4-12, PLSCR1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDC42EP1