CDC40 Antibody


Immunocytochemistry/ Immunofluorescence: CDC40 Antibody [NBP2-58541] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF

Order Details

CDC40 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKT
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CDC40 Recombinant Protein Antigen (NBP2-58541PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for CDC40 Antibody

  • cell division cycle 40 homolog (S. cerevisiae)
  • cell division cycle 40 homolog (yeast)
  • Cell division cycle 40 homolog
  • Ehb3
  • EH-binding protein 3
  • hPRP17
  • MGC102802
  • pre-mRNA splicing factor 17
  • pre-mRNA-processing factor 17
  • PRP17 homolog
  • PRP17EHB3PRPF17FLJ10564


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CDC40 Antibody (NBP2-58541) (0)

There are no publications for CDC40 Antibody (NBP2-58541).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC40 Antibody (NBP2-58541) (0)

There are no reviews for CDC40 Antibody (NBP2-58541). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CDC40 Antibody (NBP2-58541) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CDC40 Products

Bioinformatics Tool for CDC40 Antibody (NBP2-58541)

Discover related pathways, diseases and genes to CDC40 Antibody (NBP2-58541). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC40 Antibody (NBP2-58541)

Discover more about diseases related to CDC40 Antibody (NBP2-58541).

Pathways for CDC40 Antibody (NBP2-58541)

View related products by pathway.

PTMs for CDC40 Antibody (NBP2-58541)

Learn more about PTMs related to CDC40 Antibody (NBP2-58541).

Blogs on CDC40

There are no specific blogs for CDC40, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CDC40 Antibody and receive a gift card or discount.


Gene Symbol CDC40