CDC40 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CDC40 Antibody [NBP2-58541] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDC40 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKT
Specificity
Specificity of human CDC40 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDC40
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CDC40 Recombinant Protein Antigen (NBP2-58541PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CDC40 Antibody

  • cell division cycle 40 homolog (S. cerevisiae)
  • cell division cycle 40 homolog (yeast)
  • Cell division cycle 40 homolog
  • Ehb3
  • EH-binding protein 3
  • hPRP17
  • MGC102802
  • pre-mRNA splicing factor 17
  • pre-mRNA-processing factor 17
  • PRP17 homolog
  • PRP17EHB3PRPF17FLJ10564

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92297
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1713
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-20403
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-85720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00027339-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-90226
Species: Hu
Applications: IHC, IHC-P
AF2156
Species: Hu, Mu
Applications: WB, IHC
NBP1-84010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46033
Species: Hu
Applications: WB, IHC
NBP1-31758
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00056949-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88523
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1774
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
NBP1-81865
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CDC40 Antibody (NBP2-58541) (0)

There are no publications for CDC40 Antibody (NBP2-58541).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC40 Antibody (NBP2-58541) (0)

There are no reviews for CDC40 Antibody (NBP2-58541). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CDC40 Antibody (NBP2-58541) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDC40 Products

Bioinformatics Tool for CDC40 Antibody (NBP2-58541)

Discover related pathways, diseases and genes to CDC40 Antibody (NBP2-58541). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC40 Antibody (NBP2-58541)

Discover more about diseases related to CDC40 Antibody (NBP2-58541).
 

Pathways for CDC40 Antibody (NBP2-58541)

View related products by pathway.

PTMs for CDC40 Antibody (NBP2-58541)

Learn more about PTMs related to CDC40 Antibody (NBP2-58541).

Blogs on CDC40

There are no specific blogs for CDC40, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDC40 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC40