CDC2/CDK1 Antibody (8F1)

Images

 
Western Blot: CDC2/CDK1 Antibody (8F1) [H00000983-M04] - Analysis of CDC2 expression in Raw 264.7 (Cat # L024V1).
Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody (8F1) [H00000983-M04] - Analysis of monoclonal antibody to CDC2 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 1.5 ug/ml
Western Blot: CDC2/CDK1 Antibody (8F1) [H00000983-M04] - Analysis of CDC2 expression in PC-12 (Cat # L012V1).
Western Blot: CDC2/CDK1 Antibody (8F1) [H00000983-M04] - Analysis of CDC2 expression in Hela S3 NE (Cat # L013V3).
Western Blot: CDC2/CDK1 Antibody (8F1) [H00000983-M04] - Analysis of CDC2 expression in NIH/3T3 (Cat # L018V1).
ELISA: CDC2/CDK1 Antibody (8F1) [H00000983-M04] - Detection limit for recombinant GST tagged CDC2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
8F1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CDC2/CDK1 Antibody (8F1) Summary

Immunogen
CDC2 (AAH14563 211 a.a. - 297 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Specificity
CDC2 - cell division cycle 2, G1 to S and G2 to M
Isotype
IgG2a Lambda
Clonality
Monoclonal
Host
Mouse
Gene
CDK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CDC2/CDK1 Antibody (8F1)

  • CDC2
  • CDC28A
  • CDC2MGC111195
  • CDK1
  • cell cycle controller CDC2
  • Cell division control protein 2 homolog
  • Cell division protein kinase 1
  • cyclin-dependent kinase 1
  • DKFZp686L20222
  • EC 2.7.11.22
  • EC 2.7.11.23
  • G1 to S and G2 to M
  • p34 protein kinase
  • P34CDC2

Background

The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000902-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP1-87905
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33506
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-85538
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
H00000983-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P

Publications for CDC2/CDK1 Antibody (H00000983-M04) (0)

There are no publications for CDC2/CDK1 Antibody (H00000983-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC2/CDK1 Antibody (H00000983-M04) (0)

There are no reviews for CDC2/CDK1 Antibody (H00000983-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDC2/CDK1 Antibody (H00000983-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDC2/CDK1 Products

Bioinformatics Tool for CDC2/CDK1 Antibody (H00000983-M04)

Discover related pathways, diseases and genes to CDC2/CDK1 Antibody (H00000983-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC2/CDK1 Antibody (H00000983-M04)

Discover more about diseases related to CDC2/CDK1 Antibody (H00000983-M04).
 

Pathways for CDC2/CDK1 Antibody (H00000983-M04)

View related products by pathway.

PTMs for CDC2/CDK1 Antibody (H00000983-M04)

Learn more about PTMs related to CDC2/CDK1 Antibody (H00000983-M04).
 

Research Areas for CDC2/CDK1 Antibody (H00000983-M04)

Find related products by research area.

Blogs on CDC2/CDK1

There are no specific blogs for CDC2/CDK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDC2/CDK1 Antibody (8F1) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK1
Entrez
OMIM
Uniprot