CD99-L2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CD99-L2 Antibody [NBP1-85737] - Staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.

Staining of human rectum shows strong membranous positivity in lymphoid cells.

Staining of human fallopian tube shows strong positivity in microvilli in glandular cells.

Staining of human cerebral cortex shows strong membranous positivity in neuropil.

Staining of human placenta shows strong positivity in microvilli in trophoblastic cells.

Analysis in control (vector only transfected HEK293T lysate) and CD99L2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD99-L2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CD99-L2 Antibody - BSA Free (NBP1-85737) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD99L2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  CD99-L2 Protein (NBP1-85737PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CD99-L2 Antibody - BSA Free

• CD99 antigen
• CD99 antigen-like 2
• CD99 antigen-like protein 2
• CD99 molecule-like 2
• CD99B
• CD99L2
• CD99-L2
• DKFZp761H2024
• MIC2 like 1
• MIC2L1
• MIC2-like protein 1

Background

CD99L2 may function as a homophilic adhesion molecule. Functions in leukocyte-endothelial cell interactions duringleukocyte extravasation, and in particular, at the diapedesis step. Does not seem to be involved in docking ofleukocytes to the vessel wall or in ly

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD99L2