CD84/SLAMF5 Antibody - BSA Free

Immunohistochemistry-Paraffin: CD84/SLAMF5 Antibody [NBP2-49635] -Staining of human colon shows strong cytoplasmic positivity in mast cells.

Immunohistochemistry-Paraffin: CD84/SLAMF5 Antibody [NBP2-49635] -Staining of human placenta shows no cytoplasmic positivity in trophoblastic cells as expected.

Immunohistochemistry-Paraffin: CD84/SLAMF5 Antibody [NBP2-49635] - Staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: CD84/SLAMF5 Antibody [NBP2-49635] -Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD84/SLAMF5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CD84/SLAMF5 Antibody - BSA Free (NBP2-49635) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RRQGRIFPEDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD84
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CD84/SLAMF5 Recombinant Protein Antigen (NBP2-49635PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CD84/SLAMF5 Antibody - BSA Free

• CD84 antigen (leukocyte antigen)
• CD84 antigen
• CD84 molecule
• CD84
• Cell surface antigen MAX.3
• DKFZp781E2378
• hCD84
• hly9-beta
• leucocyte differentiation antigen CD84
• leukocyte antigen CD84
• Leukocyte differentiation antigen CD84
• Ly-9B
• mCD84
• Signaling lymphocytic activation molecule 5
• SLAM family member 5
• SLAMF5
• SLAMF5LY9B

Background

CD84 is a 64-82 kD glycoprotein. It is a member of the SLAM (CD150) family, a CD2 subset of the Ig superfamily, also known as SLAMF5 or Ly9b. CD84 is expressed on B cells, monocytes, thymocytes, subset of T cells, and platelets. CD84 functions as a homophilic adhesion molecule and enhances T cell activation and cytokine production. CD84 is expressed on mature B cells and B cell lines but not on plasma cell lines. Immunohistochemical studies demonstrate that it strongly stains tissue macrophages. It is also expressed on platelets and at low levels on blood T cells. Cellular expression does not significantly increase after activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD84