CD84/SLAMF5 Antibody


Immunohistochemistry-Paraffin: CD84/SLAMF5 Antibody [NBP2-49635] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry: CD84/SLAMF5 Antibody [NBP2-49635] - Staining of human small intestine shows strong cytoplasmic positivity in inflammatory cells.
Immunohistochemistry-Paraffin: CD84/SLAMF5 Antibody [NBP2-49635] - Staining of human appendix shows high expression.
Immunohistochemistry-Paraffin: CD84/SLAMF5 Antibody [NBP2-49635] - Staining in human appendix and pancreas tissues using anti-CD84 antibody. Corresponding CD84 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

CD84/SLAMF5 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: RRQGRIFPEDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTS
Specificity of human CD84/SLAMF5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD84/SLAMF5 Recombinant Protein Antigen (NBP2-49635PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CD84/SLAMF5 Antibody

  • CD84 antigen (leukocyte antigen)
  • CD84 antigen
  • CD84 molecule
  • CD84
  • Cell surface antigen MAX.3
  • DKFZp781E2378
  • hCD84
  • hly9-beta
  • leucocyte differentiation antigen CD84
  • leukocyte antigen CD84
  • Leukocyte differentiation antigen CD84
  • Ly-9B
  • mCD84
  • Signaling lymphocytic activation molecule 5
  • SLAM family member 5
  • SLAMF5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA
Species: Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Mu
Applications: WB, Flow, CyTOF-ready
Species: Mu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, Simple Western
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr, B/N
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, Flow, IHC

Publications for CD84/SLAMF5 Antibody (NBP2-49635) (0)

There are no publications for CD84/SLAMF5 Antibody (NBP2-49635).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD84/SLAMF5 Antibody (NBP2-49635) (0)

There are no reviews for CD84/SLAMF5 Antibody (NBP2-49635). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD84/SLAMF5 Antibody (NBP2-49635) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CD84/SLAMF5 Antibody (NBP2-49635)

Discover related pathways, diseases and genes to CD84/SLAMF5 Antibody (NBP2-49635). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD84/SLAMF5 Antibody (NBP2-49635)

Discover more about diseases related to CD84/SLAMF5 Antibody (NBP2-49635).

Pathways for CD84/SLAMF5 Antibody (NBP2-49635)

View related products by pathway.

PTMs for CD84/SLAMF5 Antibody (NBP2-49635)

Learn more about PTMs related to CD84/SLAMF5 Antibody (NBP2-49635).

Blogs on CD84/SLAMF5

There are no specific blogs for CD84/SLAMF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CD84/SLAMF5 Antibody and receive a gift card or discount.


Gene Symbol CD84