CD84/SLAMF5 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit CD84/SLAMF5 Antibody - BSA Free (NBP2-49635) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: RRQGRIFPEDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CD84 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:5000 - 1:10000
- Immunohistochemistry-Paraffin 1:5000 - 1:10000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for CD84/SLAMF5 Antibody - BSA Free
Background
CD84 is a 64-82 kD glycoprotein. It is a member of the SLAM (CD150) family, a CD2 subset of the Ig superfamily, also known as SLAMF5 or Ly9b. CD84 is expressed on B cells, monocytes, thymocytes, subset of T cells, and platelets. CD84 functions as a homophilic adhesion molecule and enhances T cell activation and cytokine production. CD84 is expressed on mature B cells and B cell lines but not on plasma cell lines. Immunohistochemical studies demonstrate that it strongly stains tissue macrophages. It is also expressed on platelets and at low levels on blood T cells. Cellular expression does not significantly increase after activation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Mu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, WB
Species: Hu
Applications: AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Mu
Applications: ELISA
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: B/N, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Publications for CD84/SLAMF5 Antibody (NBP2-49635) (0)
There are no publications for CD84/SLAMF5 Antibody (NBP2-49635).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CD84/SLAMF5 Antibody (NBP2-49635) (0)
There are no reviews for CD84/SLAMF5 Antibody (NBP2-49635).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for CD84/SLAMF5 Antibody (NBP2-49635) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CD84/SLAMF5 Products
Research Areas for CD84/SLAMF5 Antibody (NBP2-49635)
Find related products by research area.
|
Blogs on CD84/SLAMF5