We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human CD81 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human CD81 Protein [H00000975-Q01]

Product Details

Summary
Product Discontinued
View other related CD81 Peptides and Proteins

Order Details


    • Catalog Number
      H00000975-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human CD81 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 25-127 of Human CD81

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFY

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CD81
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.96 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00000975-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD81 GST (N-Term) Protein

  • CD81 antigen (target of antiproliferative 1)
  • CD81 antigen
  • CD81 molecule
  • CD81
  • CVID6
  • TAPA1
  • TAPA-1
  • Target of the antiproliferative 1
  • Tetraspanin-28
  • TSPAN28
  • Tspan-28
  • tspan-28,26 kDa cell surface protein TAPA-1
  • TSPAN28S5.7

Background

CD81 - CD81 antigen (target of antiproliferative antibody 1)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB500-327
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, In vitro, WB
NBP2-42225
Species: Ca, Hu
Applications: B/N, DB, EM, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC-WhMt, IP, In vitro, WB
NBP2-21792
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC,  IHC-P, WB
H00009076-M01
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB400-104
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PLA, Simple Western, WB
NBP2-67605
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, ISH, WB
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
MAB4609
Species: Mu
Applications: CyTOF-ready, Flow, ICC
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-92405
Species: Hu, Mu, Rt
Applications: WB
NB500-393
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IHC-Fr, IP, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO

Publications for CD81 Partial Recombinant Protein (H00000975-Q01)(1)

Reviews for CD81 Partial Recombinant Protein (H00000975-Q01) (0)

There are no reviews for CD81 Partial Recombinant Protein (H00000975-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD81 Partial Recombinant Protein (H00000975-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD81 Products

Research Areas for CD81 Partial Recombinant Protein (H00000975-Q01)

Find related products by research area.

Blogs on CD81.

Glypican 3 as a biomarker for gastro-esophageal adenocarcinoma
By Jamshed Arslan, Pharm. D., PhD. Gastroesophageal adenocarcinoma originates from the glandular epithelium of the esophagus, gastroesophageal junction and stomach. The incidence of gastroesophageal adenocarcinoma is ...  Read full blog post.

Tools for Isolation, Quantification and Analysis of Exosomes
Exosomes are spherical to cup-shaped bilayered membrane enclosed nanosize vesicles (30-100 nm) which have the ability to shuttle active cargoes between cells. Johnstone et al. 1987 pioneered in documenting the generation of exosomes in differentiat...  Read full blog post.

CD19: An Undoubted Biomarker for B Cells
CD19 is a cell surface protein member of the large immunoglobulin superfamily that complexes with CD21, CD81, and CD225 in the membrane of mature B-cells. A major function of CD19 is to assemble with the antigen receptor of B-lymphocytes to decrease t...  Read full blog post.

CD81/TAPA1: I'm on Tapa the Cell
Target of the antiproliferative 1 (TAPA1), also known as CD81, is found in the plasma membrane in lymphocytes and plays an important role in the regulation of lymphoma cell growth. This transmembrane 4 superfamily (TM4SF) protein is primarily found on...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD81 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CD81