CD79A Antibody - BSA Free

Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD79A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CD79A Antibody - BSA Free (NBP3-24725) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein CD79A using the following amino acid sequence: ALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CD79A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CD79A Antibody - BSA Free

• CD79A antigen (immunoglobulin-associated alpha)
• CD79a antigen
• CD79a molecule, immunoglobulin-associated alpha
• CD79A
• IGAB-cell antigen receptor complex-associated protein alpha chain
• ig-alpha
• MB-1 membrane glycoprotein
• MB1
• MB-1
• Membrane-bound immunoglobulin-associated protein
• Surface IgM-associated protein

Background

CD79a is a disulphide-linked heterodimer, consisting of mb-1 (or CD79a) and B29 (or CD79b) polypeptides, is non-covalently associated with membrane-bound immunoglobulins on B cells to constitute the B cell Ag receptor. CD79a first appears at pre B cell stage and persists until the plasma cell stage where it is found as an intracellular component. CD79a is found in the majority of acute leukemias of precursor B cell type, in B cell lines, B cell lymphomas, and in some myelomas. It is not present in myeloid or T cell lines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CD79A