CD77 Synthase Antibody

Images

 
Western Blot: CD77 Synthase Antibody [NBP1-90824] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: CD77 Synthase Antibody [NBP1-90824] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD77 Synthase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:WEPYLLPVLSDASRIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
A4GALT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Application Notes
ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Expected cross-reactivity based on sequence identity: Mouse (86%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD77 Synthase Antibody

  • A14GALTalpha 1,4-galactosyltransferase (globotriaosylceramide synthase, P blood group)
  • A4GALT1
  • alpha 1,4-galactosyltransferase
  • Alpha-1,4-galactosyltransferase
  • alpha-1,4-N-acetylglucosaminyltransferase
  • alpha4Gal-T1
  • CD77 synthase
  • EC 2.4.1.228
  • Gb3 synthase
  • Gb3S
  • Globotriaosylceramide synthase
  • lactosylceramide 4-alpha-galactosyltransferase
  • P blood group (P one antigen)
  • P(k) antigen synthase
  • P(k)
  • P1
  • P1/Pk synthase
  • PK
  • UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
AF5866
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-65538
Species: Hu
NBP1-59401
Species: Hu, Po, Bv, Rb
Applications: WB
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-57528
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57999
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb
Applications: WB, ICC/IF, IHC, IP
NBP1-59875
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-38323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-90824
Species: Hu
Applications: WB, ICC/IF

Publications for CD77 Synthase Antibody (NBP1-90824) (0)

There are no publications for CD77 Synthase Antibody (NBP1-90824).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD77 Synthase Antibody (NBP1-90824) (0)

There are no reviews for CD77 Synthase Antibody (NBP1-90824). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CD77 Synthase Antibody (NBP1-90824) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CD77 Synthase Products

Bioinformatics Tool for CD77 Synthase Antibody (NBP1-90824)

Discover related pathways, diseases and genes to CD77 Synthase Antibody (NBP1-90824). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD77 Synthase Antibody (NBP1-90824)

Discover more about diseases related to CD77 Synthase Antibody (NBP1-90824).

Blogs on CD77 Synthase

There are no specific blogs for CD77 Synthase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD77 Synthase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol A4GALT
Entrez
Uniprot