CD55/DAF Recombinant Protein Antigen

Images

 
There are currently no images for CD55/DAF Protein (NBP1-85466PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD55/DAF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD55.

Source: E. coli

Amino Acid Sequence: PDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD55
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85466.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD55/DAF Recombinant Protein Antigen

  • CD55 antigen
  • CD55 molecule, decay accelerating factor for complement (Cromer blood group)
  • CD55
  • CR
  • CRdecay accelerating factor for complement (CD55, Cromer blood group system)
  • CROMDAFcomplement decay-accelerating factor
  • DAF
  • decay accelerating factor for complement
  • TC

Background

CD55 encodes a protein involved in the regulation of the complement cascade. The encoded glycoprotein is also known as the decay-accelerating factor (DAF); binding of DAF to complement proteins accelerates their decay, disrupting the cascade and preventing damage to host cells. Antigens present on the DAF glycoprotein constitute the Cromer blood group system (CROM). Two alternatively spliced transcripts encoding different proteins have been identified. The predominant transcript encodes a membrane-bound protein expressed on cells exposed to plasma component proteins but an alternatively spliced transcript produces a soluble protein present at much lower levels. Additional, alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF1106
Species: Hu
Applications: IP, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
NB500-330
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr,  IHC-P, IP
MAB2005
Species: Hu
Applications: CyTOF-ready, Flow, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
DY1707
Species: Hu
Applications: ELISA
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: ICC/IF, IF, IHC,  IHC-P, MI, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-90214
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-85466PEP
Species: Hu
Applications: AC

Publications for CD55/DAF Protein (NBP1-85466PEP) (0)

There are no publications for CD55/DAF Protein (NBP1-85466PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD55/DAF Protein (NBP1-85466PEP) (0)

There are no reviews for CD55/DAF Protein (NBP1-85466PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD55/DAF Protein (NBP1-85466PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD55/DAF Products

Research Areas for CD55/DAF Protein (NBP1-85466PEP)

Find related products by research area.

Blogs on CD55/DAF

There are no specific blogs for CD55/DAF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD55/DAF Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD55