CD53 Recombinant Protein Antigen

Images

 
There are currently no images for CD53 Protein (NBP2-14464PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD53 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD53.

Source: E. coli

Amino Acid Sequence: NEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD53
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14464.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD53 Recombinant Protein Antigen

  • antigen MOX44 identified by monoclonal MRC-OX44
  • CD53 antigentetraspanin-25
  • CD53 glycoprotein
  • CD53 molecule
  • CD53 tetraspan antigen
  • CD53
  • cell surface antigen
  • Cell surface glycoprotein CD53
  • MOX44
  • MOX44transmembrane glycoprotein
  • Tetraspanin-25
  • TSPAN25
  • Tspan-25
  • TSPAN25leukocyte surface antigen CD53

Background

The antibody reacts with CD53 antigen, a glycoprotein of 32-40 kDa belonging to the tetraspans family (TM4SF). CD53 antigen is exclusivelly expressed on leucocytes (not present on platelets, red blood cells and non-hematopoietic cells). CD53 is important for signal transduction. CD53 cross-linking promotes activation of human B cells and rat macrophages.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP2-42225
Species: Ca, Hu
Applications: B/N, DB, EM, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC-WhMt, IP, In vitro, WB
NB500-327
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, In vitro, WB
NBP2-21792
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB100-65805
Species: Gt, Hu, Mu, Pm, Sh
Applications: CyTOF-ready, DB, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-28869
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
MAB3595
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
MAB4609
Species: Mu
Applications: CyTOF-ready, Flow, ICC
NBP1-80656
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
AF796
Species: Mu
Applications: AdBlk, IHC, WB
NBP1-59438
Species: Hu
Applications: IHC,  IHC-P, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP2-33867
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB

Publications for CD53 Protein (NBP2-14464PEP) (0)

There are no publications for CD53 Protein (NBP2-14464PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD53 Protein (NBP2-14464PEP) (0)

There are no reviews for CD53 Protein (NBP2-14464PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD53 Protein (NBP2-14464PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD53 Products

Research Areas for CD53 Protein (NBP2-14464PEP)

Find related products by research area.

Blogs on CD53.

CD81/TAPA1: I'm on Tapa the Cell
Target of the antiproliferative 1 (TAPA1), also known as CD81, is found in the plasma membrane in lymphocytes and plays an important role in the regulation of lymphoma cell growth. This transmembrane 4 superfamily (TM4SF) protein is primarily found on...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD53 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD53